KEGG   Oryzias latipes (Japanese medaka): 101167160Help
Entry
101167160         CDS       T02443                                 

Definition
protein O-mannosyl-transferase 2-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ola00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 753 aa AA seqDB search
MDKADCPSQNKTKDFSTLRNRKICASKAQQSSFSLVSKHKNVQPAEMSKDGTQLPSPPGH
EPRNKTLLILVVVLSFSTRFYKLAEPPHVCWDETHFGKMGSYYINRTFFFDVHPPLGKML
IGFAGFMTGYDGTFPFIKPGDKYEEHNYLGMRGFCAALGSCLPIFAYLIVLELSQAQSAA
LIAASLLIFDTGCITISQYILLDPILMFFIMAAVLSMIKFNQQRYRPFTAPWWMWLVLCG
ANLSGAVGVKFVGLFIIVLVGLNTISDLWVLLGDLNLSLVDVLKHLLARVAGLILLPLFL
YVTIFAVHFVVLNKSGPGDGFFSSAFQSRLIGNNLHNVSMPEYLAYGSTITAKNLRIAGG
YLHSHWHLYPEGVGAKQQQVTAYLHKDYNNLWLVRKPEENDSESRTPVLVRHGDIIRLEH
KETTRNLHAHRQEAPLTKKHFQVTGYGINGTGDSNDLWRVEVCGGQRGDLVKVLRSKVRF
LHKATGCVLYSSGKTLPKWGWEQVEVTCSPYLKESPSSQWNIEDHFHPELPNISLSVLKP
NFLEILLESHIVMIKGNSGLKAKDNEMNSKPWHWPINYQGLRFSGVNETEYRVYLLGNPV
VWWINLASLGLYVIMVAVASIAIKRGLPLNQSRLEHSRLLKRGGGLLLLGWLLHYLPFYA
MGRVLYYHHYFPAMLFSSMLTGVTLDILLKSSDLLLHSVYSDRLKVGGWLLLQLSILYSF
YLFHPLSYGMMGPLAHEPGSAMAGLKWIDSWDF
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagcagactgcccatcccaaaacaaaacaaaggacttttcaactctacgaaac
aggaaaatctgtgcctccaaagcacaacaatcatccttcagccttgtgtcaaagcacaaa
aatgtccaacctgcagaaatgtcaaaagatggcacacagcttccatcccctccaggccac
gagccaagaaacaaaacactccttattcttgttgtggtgttgtctttctctacacgcttc
tacaagttagcagagccccctcacgtgtgctgggatgaaacgcactttggaaaaatgggg
agctactacatcaacagaaccttcttcttcgacgtccatccgcctctcgggaaaatgctg
attggttttgctggttttatgactggttatgatggtacttttccctttatcaaacctgga
gacaaatatgaagaacacaactatctcgggatgagaggattttgtgctgcactgggctcc
tgccttcctatctttgcctacctcatcgtgctggagctgtctcaggctcaaagtgctgct
ctcatagcagccagcctgctcatatttgacacaggctgcatcactatctcacagtacatc
ctgttagacccaatactgatgttcttcattatggcggcagtactgagtatgatcaagttc
aaccagcagagatacaggcctttcactgccccctggtggatgtggctggtactgtgtggc
gcaaacctctctggggctgttggggtgaagtttgttggcctgtttataatcgttttagtt
ggcctgaacacaatttcggacctttgggttcttttgggagacctgaatctgtctctggtg
gacgttttaaagcacttgcttgctcgagtggctgggctcatcctccttccgctcttcctc
tacgttacaatatttgcagtccactttgttgtgttgaacaaaagtgggcccggtgacggt
ttcttcagctctgctttccagtcccgcctaattggaaacaacctgcacaatgtatccatg
ccagagtacctggcgtacggctcaaccatcacagcaaaaaacctccgtattgctggcggt
taccttcactcccactggcacctctacccagagggggttggagcaaagcaacagcaggtt
acagcctatctccataaagactacaacaacctgtggctggttcgaaaaccggaggagaac
gattctgagtccaggactccggttctggttcgtcatggagacatcattcgactggagcac
aaagaaacaactcggaacctccacgcccaccgtcaggaagctcctctcaccaaaaagcat
tttcaggtgaccggctacggcattaatggaaccggagactccaatgatctgtggcgagtg
gaggtttgtggaggccagaggggcgacctggtgaaggtactgcggagcaaagttcgcttt
ctgcacaaagctaccggctgtgtcctctactcctctggaaagactcttccaaaatggggg
tgggaacaggtcgaggtcacctgcagtccttacttgaaggagtctccaagctcacagtgg
aacattgaggatcattttcatccagaattgcccaacattagtttgtccgtgctgaagccc
aactttctggaaatcttgttggagtcccacatagttatgataaagggaaacagtggcttg
aaagccaaagacaatgagatgaactccaaaccttggcactggcctatcaactaccagggc
ctgagattttcaggcgtaaatgagacggagtatcgcgtttacctgctgggaaacccagtg
gtctggtggataaatctggcctctttagggctgtacgtcatcatggtggcagtggcgtcc
attgccataaagagaggtttgcccttgaaccaaagccgactagagcattcacggctcctg
aagagaggaggaggcctgctgctgctcggctggctgctgcactacctccccttctacgcc
atgggccgcgtcctgtactatcaccactacttccccgccatgctcttcagcagcatgctg
acgggagttacactggacatccttcttaaaagctctgacctgctgctccactctgtttat
tctgaccggctgaaagttggtggatggctgctacttcagctcagcatcctttacagtttc
tacctttttcatcctctgtcctatggcatgatgggtcctcttgcccatgagccgggcagt
gccatggcaggcctgaagtggatagactcctgggacttctag

DBGET integrated database retrieval system