KEGG   Oryzias latipes (Japanese medaka): 101167160Help
Entry
101167160         CDS       T02443                                 

Definition
protein O-mannosyl-transferase 2-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    101167160
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     101167160
Glycosyltransferases [BR:ola01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   101167160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 753 aa AA seqDB search
MDKADCPSQNKTKDFSTLRNRKICASKAQQSSFSLVSKHKNVQPAEMSKDGTQLPSPPGH
EPRNKTLLILVVVLSFSTRFYKLAEPPHVCWDETHFGKMGSYYINRTFFFDVHPPLGKML
IGFAGFMTGYDGTFPFIKPGDKYEEHNYLGMRGFCAALGSCLPIFAYLIVLELSQAQSAA
LIAASLLIFDTGCITISQYILLDPILMFFIMAAVLSMIKFNQQRYRPFTAPWWMWLVLCG
ANLSGAVGVKFVGLFIIVLVGLNTISDLWVLLGDLNLSLVDVLKHLLARVAGLILLPLFL
YVTIFAVHFVVLNKSGPGDGFFSSAFQSRLIGNNLHNVSMPEYLAYGSTITAKNLRIAGG
YLHSHWHLYPEGVGAKQQQVTAYLHKDYNNLWLVRKPEENDSESRTPVLVRHGDIIRLEH
KETTRNLHAHRQEAPLTKKHFQVTGYGINGTGDSNDLWRVEVCGGQRGDLVKVLRSKVRF
LHKATGCVLYSSGKTLPKWGWEQVEVTCSPYLKESPSSQWNIEDHFHPELPNISLSVLKP
NFLEILLESHIVMIKGNSGLKAKDNEMNSKPWHWPINYQGLRFSGVNETEYRVYLLGNPV
VWWINLASLGLYVIMVAVASIAIKRGLPLNQSRLEHSRLLKRGGGLLLLGWLLHYLPFYA
MGRVLYYHHYFPAMLFSSMLTGVTLDILLKSSDLLLHSVYSDRLKVGGWLLLQLSILYSF
YLFHPLSYGMMGPLAHEPGSAMAGLKWIDSWDF
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagcagactgcccatcccaaaacaaaacaaaggacttttcaactctacgaaac
aggaaaatctgtgcctccaaagcacaacaatcatccttcagccttgtgtcaaagcacaaa
aatgtccaacctgcagaaatgtcaaaagatggcacacagcttccatcccctccaggccac
gagccaagaaacaaaacactccttattcttgttgtggtgttgtctttctctacacgcttc
tacaagttagcagagccccctcacgtgtgctgggatgaaacgcactttggaaaaatgggg
agctactacatcaacagaaccttcttcttcgacgtccatccgcctctcgggaaaatgctg
attggttttgctggttttatgactggttatgatggtacttttccctttatcaaacctgga
gacaaatatgaagaacacaactatctcgggatgagaggattttgtgctgcactgggctcc
tgccttcctatctttgcctacctcatcgtgctggagctgtctcaggctcaaagtgctgct
ctcatagcagccagcctgctcatatttgacacaggctgcatcactatctcacagtacatc
ctgttagacccaatactgatgttcttcattatggcggcagtactgagtatgatcaagttc
aaccagcagagatacaggcctttcactgccccctggtggatgtggctggtactgtgtggc
gcaaacctctctggggctgttggggtgaagtttgttggcctgtttataatcgttttagtt
ggcctgaacacaatttcggacctttgggttcttttgggagacctgaatctgtctctggtg
gacgttttaaagcacttgcttgctcgagtggctgggctcatcctccttccgctcttcctc
tacgttacaatatttgcagtccactttgttgtgttgaacaaaagtgggcccggtgacggt
ttcttcagctctgctttccagtcccgcctaattggaaacaacctgcacaatgtatccatg
ccagagtacctggcgtacggctcaaccatcacagcaaaaaacctccgtattgctggcggt
taccttcactcccactggcacctctacccagagggggttggagcaaagcaacagcaggtt
acagcctatctccataaagactacaacaacctgtggctggttcgaaaaccggaggagaac
gattctgagtccaggactccggttctggttcgtcatggagacatcattcgactggagcac
aaagaaacaactcggaacctccacgcccaccgtcaggaagctcctctcaccaaaaagcat
tttcaggtgaccggctacggcattaatggaaccggagactccaatgatctgtggcgagtg
gaggtttgtggaggccagaggggcgacctggtgaaggtactgcggagcaaagttcgcttt
ctgcacaaagctaccggctgtgtcctctactcctctggaaagactcttccaaaatggggg
tgggaacaggtcgaggtcacctgcagtccttacttgaaggagtctccaagctcacagtgg
aacattgaggatcattttcatccagaattgcccaacattagtttgtccgtgctgaagccc
aactttctggaaatcttgttggagtcccacatagttatgataaagggaaacagtggcttg
aaagccaaagacaatgagatgaactccaaaccttggcactggcctatcaactaccagggc
ctgagattttcaggcgtaaatgagacggagtatcgcgtttacctgctgggaaacccagtg
gtctggtggataaatctggcctctttagggctgtacgtcatcatggtggcagtggcgtcc
attgccataaagagaggtttgcccttgaaccaaagccgactagagcattcacggctcctg
aagagaggaggaggcctgctgctgctcggctggctgctgcactacctccccttctacgcc
atgggccgcgtcctgtactatcaccactacttccccgccatgctcttcagcagcatgctg
acgggagttacactggacatccttcttaaaagctctgacctgctgctccactctgtttat
tctgaccggctgaaagttggtggatggctgctacttcagctcagcatcctttacagtttc
tacctttttcatcctctgtcctatggcatgatgggtcctcttgcccatgagccgggcagt
gccatggcaggcctgaagtggatagactcctgggacttctag

DBGET integrated database retrieval system