KEGG   Oryzias latipes (Japanese medaka): 101167271Help
Entry
101167271         CDS       T02443                                 

Definition
ribonuclease pancreatic-like
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     101167271
Messenger RNA biogenesis [BR:ola03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     101167271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 148 aa AA seqDB search
MKILLSCLLILMLFDDSSLATYESFCRKHIDKDMTDMVTMVNNKCDSVIKDKNIYDNNNC
KRINTFIASDLAEVEKICTSEGTLNSQSQMMESKKMFTLINCKLKDNDAKKPNCQYEGIL
LTNRKLLVQCDNNNRPVHFGGYIAEPGF
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctgctgagctgtttgctgatcctcatgctctttgatgactcatctctggct
acatatgaaagtttttgcaggaagcacatagacaaagacatgacagacatggtaacaatg
gtaaacaacaaatgtgactcagtgataaaagacaagaacatttacgacaacaacaactgt
aaaagaatcaacactttcattgcctctgacctggctgaagtcgaaaaaatctgtacaagt
gagggaaccctaaacagtcaaagtcaaatgatggagagcaagaaaatgttcacactcatc
aactgcaaactgaaggacaacgatgccaagaaacccaactgccaatatgaaggcattctc
ctgactaacaggaagctgttggtccagtgtgacaacaacaaccggcctgttcactttggt
ggttacatagcagagcctggtttctga

DBGET integrated database retrieval system