KEGG   Oryzias latipes (Japanese medaka): 101167285Help
Entry
101167285         CDS       T02443                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1-like
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101167285
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101167285
   04070 Phosphatidylinositol signaling system
    101167285
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    101167285
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101167285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 567 aa AA seqDB search
MTELVKMKRSKAPTTRRAEIQQLYQCYSAGMTSLPSSALLKFLHKEQMELTADEDTAESL
IDRYEIEETARENRSMTFEGFLRYMESKVCCVFNQAHTSVYQDMDQPLTSYFISSSHNTY
LTGDQLIGKSHLDAYVWALRKGCRCLEIDTWDGPDMEPIVYHGYTLTTKILFKDVITTVA
QHAFEVSPYPVILSLENHCSQQQQEVMAQYLVSILGDMLLTAPLDHLAGGELPSPNDLKC
KILIKNKKKKPRIKTEQATEESADEGEEDYDDLEDEEDDEDHQTKTKFWSPRKAGPKKEE
KKVVIAEALSDLVIYTRSVKFIGFSHSRDHQSYFENTSMAEKKARKLASGSGLNFVQHNQ
RFLTRIYPAGSRMSSSNYNPQEFWNVGSQLVALNFQSLGLPMDLNDGRFQDNGGCGYVLK
PAVLLPSDRSFDPICSRHRLKPTHLLLKVISGSNLPVSRSNKGLDPFVRVEIHGIPSDSR
KKNTQTVKNNSLSPHWDSDMNFIISVPELCLIRFCVRDQTGLLSSEFVGQYTLPFTSMMK
GYRWVPLRSRDGCSLDPASLFIFVWYS
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgactgagttggtcaaaatgaagagaagcaaagcccccactaccaggagagctgagatc
cagcagctgtaccaatgctactctgctggcatgacttctttgccttcctctgcactcctg
aaatttctgcacaaggagcagatggagctcaccgcagatgaagacactgcagagagcctg
attgacagatatgagatcgaagagacggccagagaaaacagatccatgacatttgaaggc
ttcctcagatacatggagtccaaagtctgctgtgtgttcaaccaagctcacacatctgtg
tatcaagacatggaccagcctctcaccagttacttcatctcctcatcacacaacacctac
ctgactggagatcagctcataggaaagagtcacctcgatgcctacgtttgggctctgagg
aaaggctgtcgctgtttggaaattgacacttgggacggtccggacatggagcccatagtt
taccatggctacaccctgaccaccaagatactttttaaagacgtcatcaccacggtggca
caacacgcctttgaggtttcaccttacccagtgattctgtcgttggaaaaccactgcagc
cagcagcagcaggaagtcatggctcagtacctcgtctctatcctgggtgacatgctgcta
acagctcctcttgatcacttggccggtggagagcttccaagcccaaacgacctgaagtgt
aagattctcatcaagaataagaagaaaaagccaaggattaagacagaacaggcaacagag
gagagtgcagatgagggagaggaggattatgatgatctggaggatgaggaggacgatgag
gatcatcaaacaaaaacaaagttctggtctcccagaaaggcagggccaaagaaagaagag
aagaaggtggtgatagccgaggctttgtctgacctggtgatatacacgagatccgtcaag
ttcatcggcttcagtcactccagggatcatcagagctactttgaaaacacatcaatggca
gaaaagaaggctcgcaaactggccagcggctcaggactgaattttgttcagcataaccag
aggttcctcaccaggatttacccagcaggctccaggatgtcctcctccaactacaacccc
caggagttctggaacgttggctcacagctcgtggctctcaattttcaatctctgggtttg
cctatggaccttaatgacggccgtttccaagacaacgggggctgcggatacgtcctgaag
ccagcggtgctactacccagtgataggagctttgatcccatctgcagccggcaccgcctc
aaacccacacacctgctgcttaaggttatcagtggatccaaccttcctgtcagtaggagc
aataaaggcctggacccctttgtgagagtggagattcatgggataccgtcagactcccgc
aagaaaaacacccagactgtcaaaaacaactctctgagtcctcactgggacagtgacatg
aatttcatcattagcgttcctgagctctgcctcatccgcttctgtgtccgagatcagacc
ggcctccttagcagcgagtttgtgggccagtacacgctgcccttcaccagcatgatgaaa
ggctaccgctgggtgcctctccggtctcgagacggatgcagcctggatccagcttccctc
ttcatctttgtctggtattcctga

DBGET integrated database retrieval system