KEGG   Oryzias latipes (Japanese medaka): 101167483Help
Entry
101167483         CDS       T02443                                 

Gene name
lig1
Definition
(RefSeq) ligase I, DNA, ATP-dependent
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:ola00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    101167483 (lig1)
   03410 Base excision repair
    101167483 (lig1)
   03420 Nucleotide excision repair
    101167483 (lig1)
   03430 Mismatch repair
    101167483 (lig1)
Enzymes [BR:ola01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101167483 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     101167483 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101167483 (lig1)
DNA replication proteins [BR:ola03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101167483 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101167483 (lig1)
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101167483 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     101167483 (lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     101167483 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
17
AA seq 980 aa AA seqDB search
MQRSIASFFQPKSKDKDIQKKAIDEPVKKIAKSPLKVQNGVQEVDSPIKKSGKRCRQIVD
SDEDEAPLVKEQAEEQGGRKAPAKTEKKDDVFKAVPTPLSPPPAPTTPSTPATPATPASS
ASPGTPSTSDSTSPSGISKRKTARKMFPKRRLEEGRSEKAEGQSAEETGQQHKRPRVESS
TSSAGNTDEPMEEEAAAVVPGELLENEKTAEGEKAKEKEEEEEEVEEKSTDEGGEKAEKK
EEKQKTSDERGPEKVTTEETQEGKGSPKSPIVEKKQKDAKEQKDKEAAKKAPISSFFAPR
KAAAKTEKPEKSDGEKKTSAMRKNSEEDRKEPKGDSTPGQTEFDPSRPNYHPVDHACWKH
SQKVPYLAVARTFEKIEEDSGRLRNIETLSNLFRSVLLLSPDDLLCCVYLCLNQLGPAYL
GMELGVGETVLMKAVAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQRMMFQPASLTVGS
VFKKLKEIASMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLSAL
SQAVCLTPPGQDFPPAVIDASKGMSAESRRAWIEEKSLILKQTYCEMPNYDIILPVLLKE
GIDQLPNHCKLTPGVPLRPMLAHPTKGVGEVMKKFDEAAFTCEYKYDGERAQIHILESGE
VRIFSRNQEDNTSKYPDIIARIPKVKKESVVSCVLDSEAVAWDHEKKQIQPFQVLTTRKR
KDVDASEIKVQVCVYAFDLLYLNGESLVRQPLCRRRALLRDSFMEVEGEFMFARSIDSDS
TDAIAEFLEQSVRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLDGVGDTVDLCVIG
AYLGKGKRTGTYGGFLLACYDDENEEFQSVCKIGTGFKDEDLEQHYKFLKEHILPKPRAY
YRVDQSAEPDVWLDAVQVWEVKCADLSLSPVYKAAMGLVDPEKGISLRFPRFLRIRDDKK
PEDATSGSQVDQSKSFPFLI
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcattgcatcatttttccagccaaagagcaaagataaggacattcagaag
aaggcgatcgacgagccagtgaaaaaaattgccaaaagccccctcaaggtgcagaatggt
gtgcaggaagtggattcccccatcaagaagagtggcaaacgctgccgtcagatcgtagac
agcgatgaagacgaggccccgctagtgaaggagcaagcagaggagcaaggaggaaggaaa
gctcctgcaaaaacagaaaagaaggacgatgtgttcaaggcagttcccacccctctgtcc
ccaccacctgctccaaccacaccctcaacccctgctactccagctactcccgcctcttcg
gcttcaccgggaacgcccagcacctcggactccacctcaccgtcgggaatcagcaaacgc
aagactgcgaggaagatgtttcccaagaggaggctggaggagggcagaagtgagaaagca
gaggggcagtctgcagaggagacgggtcagcagcacaaacggcctcgcgtggagagcagc
accagcagtgcagggaacacggatgaacccatggaggaagaagcagcggctgtcgtccca
ggtgagctgctagaaaacgaaaagactgcagaaggagaaaaggccaaagaaaaagaagag
gaggaggaggaggtagaggaaaagagcaccgatgagggaggagagaaagctgagaaaaag
gaagaaaagcagaagacgtctgatgagcgagggcctgagaaggtcaccacagaggagacg
caagagggaaaagggagcccaaaaagtccaatcgtggaaaaaaagcagaaggacgcaaag
gagcagaaagataaggaggcggccaagaaagctccaatcagcagtttctttgctcccaga
aaagcagcagcgaagacggagaaaccagagaagagtgacggagagaagaagacgagtgcc
atgaggaagaactcagaggaagaccgtaaagaacccaaaggtgattccaccccaggacaa
acagagtttgacccctccaggccaaactaccaccctgtggaccacgcctgctggaagcac
agccagaaagtgccgtacttggcagtggctcgcacctttgagaaaattgaagaggactct
ggcaggctgaggaacattgagactctgtcgaatctgtttcgctccgtgctgctgctctct
ccagacgacctgttgtgctgtgtgtacctgtgcttgaaccagctgggcccagcctacctg
gggatggagctcggcgttggggagacggtgctgatgaaagcggttgcccaagcaactgga
cggcagttggacaaaatcaaagcagaggcccaggagaaaggagatttgggccttgtggct
gaaagttcccgtagcaaccagcggatgatgttccagcctgccagcctgacagtggggagc
gtttttaagaaactgaaggaaattgcaagcatgagtggaaactcggccatgaataagaaa
atcgacatcatcaaaggcctctttgtggcgtgccgcttttcagaggcccgctacatcgtc
aggtctctggctgggaagctgaggatcggccttgctgagcagagcgtgctctctgctctg
agccaagctgtctgcttgaccccacctggacaagatttccctcctgctgtgatcgatgcg
agtaaggggatgagtgccgagagcaggcgggcctggatcgaagagaagagtctcattctc
aagcagacgtactgcgaaatgcccaattacgacatcatcctccccgttctgctaaaggag
ggcattgaccagctccccaatcactgcaagctgactccaggcgtcccgctgaggcccatg
ctggctcaccccactaaaggtgttggagaggttatgaagaagtttgacgaggcggcgttc
acctgcgagtacaaatacgacggagagcgcgcacagattcacattctggagagcggcgaa
gtccgaatattcagccggaatcaggaagacaacaccagcaaataccccgatatcatcgct
cgcattcccaaggtgaagaaggaatctgtggtgtcctgcgtcctggactcagaagctgtg
gcctgggaccatgaaaagaaacagatccagcccttccaggttctcaccactcgaaagaga
aaggatgtggatgcctctgagatcaaagtccaggtgtgtgtgtacgcctttgacctcctc
tacctcaacggcgagtccctggtgcgacagcctttgtgtcggcgtcgggctctgctgagg
gacagtttcatggaggtggagggggagtttatgttcgcccgctccatcgacagcgacagc
actgacgccatcgccgagttcctggagcagtccgtccgagactcctgcgagggcctgatg
gtgaaaactctggagaaggatgcgacctatgagattgccaagcgttcccataattggctc
aagttgaagaaggactacctggacggcgttggtgatacggtggacctttgcgtgatcgga
gcctatctggggaaagggaaaaggaccggcacctatggtggcttcctgctggcgtgctac
gacgatgaaaacgaggagttccagtcggtttgcaagatcgggacaggcttcaaggacgaa
gatctggagcagcattacaagtttttgaaggagcacatcctgcccaaacctcgggcctat
taccgcgtcgaccaatcagccgagcccgacgtgtggctggacgccgtgcaggtgtgggag
gtgaaatgtgccgacctctcgctgtcgcccgtctacaaggccgccatgggactggtggat
ccggagaaaggcatctctctgcggtttccccgcttccttcggatcagagatgacaagaaa
cccgaggacgccacctctggatctcaggtagatcagagcaaatcgtttcccttccttatt
tga

DBGET integrated database retrieval system