KEGG   Oryzias latipes (Japanese medaka): 101167483Help
Entry
101167483         CDS       T02443                                 

Definition
DNA ligase 1-like
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:ola00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    101167483
   03410 Base excision repair
    101167483
   03420 Nucleotide excision repair
    101167483
   03430 Mismatch repair
    101167483
Enzymes [BR:ola01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101167483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 974 aa AA seqDB search
MQRSIASFFQPKSKDKDIQKKAIDEPVKKIAKSPLKVQNGVQEVDSPIKKSGKRCRQIVD
SDEDEAPLVKEQAEEQGGRKAPAKTEKKDDVFKAVPTPLSPPPAPTTPSTPATPATPASS
ASPGTPSTSDSTSPSGISKRKTARKMFPKRRLEEGRSEKAEGQSAEETGQQHKRPRVESS
TSSAGNTDEPMEEEAAAVVPGELLENEKTAEGEKAKEKEEEEEEVEEKSTDEGGEKAEKK
EEKQKTSDERGPEKVTTEETQEGKGSPKSPIVEKKQKDAKEQKDKEAAKKAPISSFFAPR
KAAAKTEKPEKSDGEKKTSAMRKNSEEDRKEPKGDSTPGQTEFDPSRPNYHPVDHACWKH
SQKVPYLAVARTFEKIEEDSGRLRNIETLSNLFRSVLLLSPDDLLCCVYLCLNQLGPAYL
GMELGVGETVLMKAVAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQRMMFQPASLTVGS
VFKKLKEIASMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLSAL
SQAVCLTPPGQDFPPAVIDASKGMSAESRRAWIEEKSLILKQTYCEMPNYDIILPVLLKE
GIDQLPNHCKLTPGVPLRPMLAHPTKGVGEVMKKFDEAAFTCEYKYDGERAQIHILESGE
VRIFSRNQEDNTSKYPDIIARIPKVKKESVVSCVLDSEAVAWDHEKKQIQPFQVLTTRKR
KDVDASEIKVQVCVYAFDLLYLNGESLVRQPLCRRRALLRDSFMEVEGEFMFARSIDSDS
TDAIAEFLEQSVRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLDGVGDTVDLCVIG
AYLGKGKRTGTYGGFLLACYDDENEEFQSVCKIGTGFKDEDLEQHYKFLKEHILPKPRAY
YRVDQSAEPDVWLDAVQVWEVKCADLSLSPVYKAAMGLVDPEKGISLRFPRFLRIRDDKK
PEDATSGSQVDMAG
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcattgcatcatttttccagccaaagagcaaagataaggacattcagaag
aaggcgatcgacgagccagtgaaaaaaattgccaaaagccccctcaaggtgcagaatggt
gtgcaggaagtggattcccccatcaagaagagtggcaaacgctgccgtcagatcgtagac
agcgatgaagacgaggccccgctagtgaaggagcaagcagaggagcaaggaggaaggaaa
gctcctgcaaaaacagaaaagaaggacgatgtgttcaaggcagttcccacccctctgtcc
ccaccacctgctccaaccacaccctcaacccctgctactccagctactcccgcctcttcg
gcttcaccgggaacgcccagcacctcggactccacctcaccgtcgggaatcagcaaacgc
aagactgcgaggaagatgtttcccaagaggaggctggaggagggcagaagtgagaaagca
gaggggcagtctgcagaggagacgggtcagcagcacaaacggcctcgcgtggagagcagc
accagcagtgcagggaacacggatgaacccatggaggaagaagcagcggctgtcgtccca
ggtgagctgctagaaaacgaaaagactgcagaaggagaaaaggccaaagaaaaagaagag
gaggaggaggaggtagaggaaaagagcaccgatgagggaggagagaaagctgagaaaaag
gaagaaaagcagaagacgtctgatgagcgagggcctgagaaggtcaccacagaggagacg
caagagggaaaagggagcccaaaaagtccaatcgtggaaaaaaagcagaaggacgcaaag
gagcagaaagataaggaggcggccaagaaagctccaatcagcagtttctttgctcccaga
aaagcagcagcgaagacggagaaaccagagaagagtgacggagagaagaagacgagtgcc
atgaggaagaactcagaggaagaccgtaaagaacccaaaggtgattccaccccaggacaa
acagagtttgacccctccaggccaaactaccaccctgtggaccacgcctgctggaagcac
agccagaaagtgccgtacttggcagtggctcgcacctttgagaaaattgaagaggactct
ggcaggctgaggaacattgagactctgtcgaatctgtttcgctccgtgctgctgctctct
ccagacgacctgttgtgctgtgtgtacctgtgcttgaaccagctgggcccagcctacctg
gggatggagctcggcgttggggagacggtgctgatgaaagcggttgcccaagcaactgga
cggcagttggacaaaatcaaagcagaggcccaggagaaaggagatttgggccttgtggct
gaaagttcccgtagcaaccagcggatgatgttccagcctgccagcctgacagtggggagc
gtttttaagaaactgaaggaaattgcaagcatgagtggaaactcggccatgaataagaaa
atcgacatcatcaaaggcctctttgtggcgtgccgcttttcagaggcccgctacatcgtc
aggtctctggctgggaagctgaggatcggccttgctgagcagagcgtgctctctgctctg
agccaagctgtctgcttgaccccacctggacaagatttccctcctgctgtgatcgatgcg
agtaaggggatgagtgccgagagcaggcgggcctggatcgaagagaagagtctcattctc
aagcagacgtactgcgaaatgcccaattacgacatcatcctccccgttctgctaaaggag
ggcattgaccagctccccaatcactgcaagctgactccaggcgtcccgctgaggcccatg
ctggctcaccccactaaaggtgttggagaggttatgaagaagtttgacgaggcggcgttc
acctgcgagtacaaatacgacggagagcgcgcacagattcacattctggagagcggcgaa
gtccgaatattcagccggaatcaggaagacaacaccagcaaataccccgatatcatcgct
cgcattcccaaggtgaagaaggaatctgtggtgtcctgcgtcctggactcagaagctgtg
gcctgggaccatgaaaagaaacagatccagcccttccaggttctcaccactcgaaagaga
aaggatgtggatgcctctgagatcaaagtccaggtgtgtgtgtacgcctttgacctcctc
tacctcaacggcgagtccctggtgcgacagcctttgtgtcggcgtcgggctctgctgagg
gacagtttcatggaggtggagggggagtttatgttcgcccgctccatcgacagcgacagc
actgacgccatcgccgagttcctggagcagtccgtccgagactcctgcgagggcctgatg
gtgaaaactctggagaaggatgcgacctatgagattgccaagcgttcccataattggctc
aagttgaagaaggactacctggacggcgttggtgatacggtggacctttgcgtgatcgga
gcctatctggggaaagggaaaaggaccggcacctatggtggcttcctgctggcgtgctac
gacgatgaaaacgaggagttccagtcggtttgcaagatcgggacaggcttcaaggacgaa
gatctggagcagcattacaagtttttgaaggagcacatcctgcccaaacctcgggcctat
taccgcgtcgaccaatcagccgagcccgacgtgtggctggacgccgtgcaggtgtgggag
gtgaaatgtgccgacctctcgctgtcgcccgtctacaaggccgccatgggactggtggat
ccggagaaaggcatctctctgcggtttccccgcttccttcggatcagagatgacaagaaa
cccgaggacgccacctctggatctcaggtggacatggcaggatga

DBGET integrated database retrieval system