KEGG   Oryzias latipes (Japanese medaka): 101167504Help
Entry
101167504         CDS       T02443                                 

Definition
mitochondrial 10-formyltetrahydrofolate dehydrogenase-like
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    101167504
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     101167504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
23
AA seq 810 aa AA seqDB search
MLWTASQVFRKFSTSSHYYQKKLKLAIIGQSLFGQEVYSSLRKQGHKVVGVFTVPDKDGK
ADPLAVAAEKDGTPLFKFPRWRNKGQPLPEVVDAYKSVGAELNVMPFCSQFIPMNVIDHP
KHGSIIYHPSILPLHRGASAINWTLIHGDEKAGFTVFWADDGLDTGPILLQRECAVEPDD
TVDTLYNRFLFPEGIKAMVESVQLIADGKAPRIPQPEEGASYEGIQRKSNARVDLAQPAK
AIHNWIRGHDKVPGAWALIGGQSVTFYGSSMLSGSVPAGQPLEIEGASQPGIISKNGLVL
FGNDGKALLVKNLQFEDGKMIPASKYFSSGENSSVELTNEEKQMAEEIRNIWKAILSNVP
AIVDTTDFFKSGAASMDVVRLVEEVKQKCAGVQLQNEDVYMATTFQDFIQIFVRKLRGED
QEEELTIDYATKEVNNMTVKMPYQCFINGKFEDAEDGKTYSTINPTDGSVICKVSYAAVG
DVDRAVAAAKEAFDNGPWGRMNPRDRGSLLYKLADLMEEHQEELATIESIDSGAVYTLAL
KTHVGMSIQTFRYFAGWCDKIQGKTIPINQARPNRNLTFTKKEPLGVCAIVIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGIPKGVINILPGSGGMVGQRLSD
HPDIRKLGFTGSTPVGKQIMKSCALSNLKKVSLELGGKSPLIIFSDCDMDKAVRMGMSSV
FFNKGENCIAAGRLFVEESIHDEYIRRVVEEIMKMKIGDPLDRSTDHGPQNHKAHLDKLL
EYCEIGVKEGATLVYGGKQVDRPGRTRQPL
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgttgtggacggcaagtcaagtcttcaggaaattctccacctcctcccattattaccag
aagaagctgaaattggccatcattggtcagagtctgtttggacaggaggtgtacagcagc
ctgaggaagcagggccacaaagtcgtgggggtgttcacagtccctgacaaagatggcaaa
gcggacccccttgcggtggctgcagagaaagacgggacaccgctgttcaagtttccacgg
tggcggaacaaggggcagcccctccctgaggtggtggacgcatacaagtctgtgggggcg
gagctcaacgtcatgcctttctgctcccagttcattcctatgaatgttattgaccatccc
aagcacggttccatcatctatcacccctccatcctgcccctgcacagaggagcctctgcc
atcaactggaccctgatccatggagatgaaaaagctggttttactgtgttctgggctgat
gatgggctggacaccggccccatcctgctgcagagagagtgtgcggtggagcctgatgac
accgtggacacactgtacaaccgcttcctcttcccagaagggatcaaagccatggtggag
tctgtgcagctcattgctgatggaaaagcccccagaattcctcagccggaggagggtgcg
agctacgagggtatccagaggaaatccaacgccagggttgacttggcccagccagctaag
gccatccacaactggatccgaggccacgacaaagtccccggagcctgggcgctcatcggt
ggtcagtcggtgactttctatggctcatccatgctgagcgggtcggtcccagccggccag
cccctggagatcgagggagcgtcccaacctggcattatctcaaagaacgggctggtgttg
tttggaaatgacgggaaggctctcctagtgaagaacctgcagtttgaagatggaaagatg
attcctgcttccaagtacttctcctctggagagaactcatctgtggagctgactaacgag
gagaagcaaatggccgaggaaataaggaacatctggaaggccatcctcagcaacgtgccg
gccatcgtggacaccacagacttttttaagtctggagctgcctccatggatgttgtcagg
ctggtagaggaggtgaagcagaagtgtgccggtgttcagctgcagaatgaggacgtatac
atggccaccaccttccaggacttcatccagatatttgtacgcaagctgaggggagaagac
caggaggaggagctcaccattgattatgcaaccaaagaagtcaacaacatgacagtgaaa
atgccataccagtgttttatcaacgggaagtttgaggatgcagaagatggcaagacctac
agtactatcaaccctacggatggatctgtgatctgtaaggtctcctatgcagcagtgggt
gacgtggaccgggcagtggctgctgctaaggaagcttttgacaacgggccttggggcagg
atgaaccccagagacagaggaagtctcctttacaagcttgcagacctgatggaggagcat
caggaggagttggccaccatcgagtccatcgactctggagctgtatacacgcttgctctg
aagactcacgtcggcatgtccattcagactttccgctactttgctggctggtgtgacaaa
attcagggcaaaaccattcccatcaaccaagccaggcccaaccgcaacctgaccttcaca
aagaaagagcctctgggagtttgtgccatagtcatcccctggaattaccccctcatgatg
ctggcttggaaaagtgcagcctgtttggcagctggaaacacgttagtgctaaaaccagca
caggtgactcctctgactgcgctgaagtttgctgagctttctgtgaaagctggaatccct
aaaggagtcattaatattctaccaggctccggtggcatggtggggcagcgtctgtccgac
catcctgacattcgcaagctgggtttcactggctccacgccggtgggcaagcagatcatg
aagagctgtgccctcagcaacctgaagaaggtttctctggagctgggcgggaagtcccct
ctcatcattttcagtgactgtgacatggacaaggccgtgcgcatgggcatgagctctgtg
ttcttcaacaaaggagagaactgcatcgctgctgggcgtctgtttgtggaggagtccatc
catgacgagtacattcgccgggtggttgaggaaattatgaagatgaaaattggtgatcct
ctggatcgatccactgatcacggcccacagaaccacaaggcccacctagacaagctcctg
gagtactgtgagatcggggtgaaggagggagccacactcgtgtatggaggcaaacaggtc
gacaggccaggtagaacgcgccaacccctctga

DBGET integrated database retrieval system