KEGG   Oryzias latipes (Japanese medaka): 101167716Help
Entry
101167716         CDS       T02443                                 

Definition
histone-lysine N-methyltransferase EHMT2-like
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101167716
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101167716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 1189 aa AA seqDB search
MSASHTTTKDDSKNVDTETSNKPIAKPSQVSQDDEDLPTPDDAEKAMPTEAVQSPLSCQQ
TQSEGGSVAEDEDTLIHAPSNKPAAGHEAKSPTSASSSLASSAPLTLSPGRAKMSVCVPT
GSKSSPPLAPSSPPFAASTSVSPSVSPSPPKIHRARKTMNRPPFGLNTGSGEVASASQTP
SGSPCLTSEPESLALKKRKLGHVSGSSCENIPDYSPTEETLFHKKVETALAKSKSCVRKT
RDEGEQSQSSTSSAQDSGNFQNGVDASERANDTEDHRLESETPKTVLNEGEESSWLLSGR
DKKRSSVDLVEMEDEEQADEYTEVPLGDLDIAAADSLTLSPPPEGSDAGDTERLEELPLC
SCRMEAPRIDSSCQRISRQCMATESLNGELRACTSWTVKGETMRPSSRVSLMVLCDVHRS
HMVKHHCCPGCGYFCIAGTFLECCPDQRIAHRFHRGCVTVLSSGRSRANGGGMIFCPHCG
EDASEAQEITLPSSSAAATSAATVVTMSASSTTTPSLPPTAPSGPSLNASTGGTKDEKMP
ERPVSARMQSHGFFTLTVEQPPQSAPVAATVTAATTPPGEEGVDSVGPSLCMPNGKPVCP
SALPPGPSRAALQKAILTQDSERRKKLRFHPRQLYPAAKQGEGQRVLLMLMEGIDPTYQP
DSQNRRSALHTAAQRGLLEICYMLIQAGAHVDAKDKEMRTPLLEAVINNHIEVARYLVQN
GACVYHVEDDGYTGLHHAAKLGNLEIVNMLLETGQVDINAQDNGGWTPIIWAAEHKHVEV
IKALLNRGADVSITDKEMNVCLHWAAYAGSVDIAEMVLNAGCSLSSVNVHGDTPLHIAAR
EGYLECVTLFLSRGADIDIVNKEGDTPLTLARTDTPVWVSLQINRKLRRGITNRLLRTER
IICRDIAQGYENVPIPCVNGVDEEGCPSDYKYVSENCETSAMNIDRNITHLQHCSCTDDC
SSSNCLCGQLSIRCWYDKDQRLLQEFNKIEPPLIFECNMACSCYRTCKNRVVQAGIKVRL
QLYRTEKMGWGVRALQDIPQGSFICEYVGELISDAEADVREDDSYLFDLDNKDGEVYCID
ARYYGNISRFINHLCDPNLIPVRVFMLHQDLRFPRIAFFSSRDILSGQELGFDYGDRFWD
IKSKYFTCQCGSEKCKHSAEAIALEQSRLARLEACSESGADCGMAIGNL
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgtcccacacaacgacaaaggatgactcaaaaaatgttgatacagaaacatcc
aacaagccaatagcaaaaccaagtcaagtaagccaagacgatgaagacctccccacgcct
gatgatgctgagaaagcgatgcccactgaggcggtgcagtcaccgctgtcatgccagcaa
acacagagtgagggtggcagtgttgcagaggatgaagatactctgatccatgcaccatca
aataaacctgcagcaggacacgaagccaagtctcctacctctgcctcttcatcactggcg
tcctccgcacctttaacgttgtcccctggccgagcaaagatgagcgtttgtgtccccacc
gggagtaaatcctctcctccacttgctccatcctctcctcccttcgccgcctcgacgtct
gtctccccgtctgtttctcccagcccacctaagatccaccgggcccgcaagaccatgaac
agacccccgtttgggctgaacactgggtctggtgaagttgcttcagcatcccagaccccg
tcaggatcgccctgcctcacctctgagcccgaaagcttggccttaaaaaagaggaagctg
ggtcatgtatcaggcagcagctgtgaaaacattccagattattctccaactgaggagacg
ttgtttcataaaaaggtggaaactgctttggcgaaaagcaaaagctgcgtgaggaagacc
agggatgaaggagaacagagccagagctccacttcatcagcacaagattctggaaacttt
caaaacggcgtcgatgcgagtgagcgcgctaatgacacggaggatcaccgtttggagtcg
gaaacaccaaaaaccgtcttgaatgagggcgaagagtcttcgtggttactgtcaggtcga
gacaaaaagagaagctcggttgacttggtggagatggaggacgaagaacaagcagacgaa
tacaccgaggttcctttgggtgacctggacatcgcagctgccgacagtctaactctttcc
cctcctcctgaaggaagcgacgccggcgacacggagaggctggaggagctccccctgtgc
agctgcaggatggaggctcctcgaatcgacagcagctgccagcgcatcagcagacagtgc
atggccacggaaagcctcaacggagagctgcgggcgtgcaccagctggaccgtgaaaggt
gagaccatgcgaccatccagccgggtctccctcatggtgctctgcgacgtccatcgctca
cacatggtcaagcaccactgttgcccagggtgtggctacttctgcatagcagggacgttc
ctagagtgctgtcctgaccagcgcatcgcccaccgtttccaccgcggctgcgtgaccgtg
ctgagcagcgggcgcagcagagccaacggcggcgggatgattttctgcccccactgtggg
gaagatgcctcagaagctcaggagatcaccctcccctcctccagcgccgccgcaacctca
gccgccacagtcgtcaccatgtccgcctcctccaccaccacgccatcgctgcccccgact
gccccttcgggaccctccctcaacgcctccacaggaggcacgaaggacgagaagatgccg
gaaagacccgttagcgctcggatgcaaagccacggcttcttcacgctgaccgtggagcag
ccgccgcagtcggcgcccgttgcagcgaccgtaaccgccgccaccacccctccaggagag
gagggagtggacagcgtggggccgtcgctctgcatgccgaatgggaagccggtctgcccg
agcgcacttccaccaggacccagcagggcggcgctgcagaaagcgatcctaacacaggac
tcagagaggaggaagaagctgaggtttcacccccgacagctctatccagccgccaagcag
ggggagggacaacgagtgctgctgatgctgatggagggaatcgatcccacgtaccagccg
gactctcagaatcggcgctccgctctccacacagcagctcaaagaggtttactggagatc
tgctacatgctgatacaggctggagctcacgtggacgccaaggacaaggaaatgaggact
cctctgctggaggccgtcatcaacaaccacattgaagtggctcgttacctagtccagaat
ggagcctgcgtctatcacgttgaggatgacggatatacgggtcttcaccacgcagccaag
ctggggaacttggaaatcgttaacatgcttttggagacggggcaggtggacataaacgca
caggacaacggaggctggactccaatcatctgggctgcagaacacaaacatgtggaggtg
atcaaggctctgctgaacagaggagcagacgtctccatcacggataaggagatgaatgtg
tgcctccactgggctgcatatgcaggaagtgtggatattgctgagatggtgttgaacgcc
ggctgctcgctgtcctccgttaacgttcacggcgacacgccgctgcacatcgctgccagg
gagggctacttggaatgtgtcacattgttcctcagcaggggtgcagacattgacatcgtg
aacaaggaaggagacacgcccctcaccctggcccggactgacacgcccgtgtgggtgtcg
ctccagatcaacaggaaactacggcgaggaataacaaaccgtcttctccggacagagaga
atcatatgccgggacatcgcacaaggctacgagaacgtgcccatcccctgcgtgaacggc
gtggacgaggagggatgcccgtccgactacaaatacgtttcagaaaactgcgaaacgtct
gcgatgaacatcgaccggaacatcacgcacttacagcactgcagctgcaccgacgactgc
tcctccagtaactgcctctgtggacagctcagcatccgctgctggtatgacaaggaccag
cggctgcttcaggagttcaacaaaatcgaacctccgctcatctttgagtgcaacatggcg
tgctcctgttaccgcacctgcaagaacagggtggttcaggccggcatcaaagtccggctg
cagctctacaggacagagaagatgggctggggagtccgagctctgcaggacatcccccaa
ggaagcttcatctgcgagtacgttggagagttgatttctgacgccgaagccgacgttcga
gaagacgactcctacctgttcgacctggataacaaggatggagaggtgtactgcatagat
gcccgttactacggcaacatcagccgcttcatcaaccacctgtgcgatccgaacctcatc
ccggtgcgggtcttcatgctgcaccaggacctgcgattcccgcgcatcgcctttttcagc
tcgcgggacatcctcagcgggcaggagctggggttcgactacggcgaccgcttctgggac
atcaagagcaagtatttcacctgccagtgcgggtcagagaagtgcaaacactcggccgaa
gccatcgccttggagcaaagcaggctggctcggctggaagcctgctcggagtcgggggcc
gactgcgggatggcgataggaaacttgtga

DBGET integrated database retrieval system