KEGG   Oryzias latipes (Japanese medaka): 101167946Help
Entry
101167946         CDS       T02443                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1-like
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101167946
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101167946
   04370 VEGF signaling pathway
    101167946
   04020 Calcium signaling pathway
    101167946
   04070 Phosphatidylinositol signaling system
    101167946
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101167946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 1305 aa AA seqDB search
MCAARFSGCLNGSAEEASCSANAPVITSRMLDWTGAGPRILHTLEMGMGLTVFYQKKSQR
PERRTFHIRQDTRQIVWCRNRDKIEGEVDIREIRELRLGKGSRDFERYPEEARKLDPTLC
FIVLYGVEFRLRTLCVAAYSEEEVNMWISGLNWMMMDTKRAPAPQQIDRWLRKQFEVMDR
SHEGSITVKEVKALLPQINYRVPNTRFLKDKLQEVEARSELSYPNFAQLYRTLMFDAQRS
IIEQLDLSFPLRNVDRPELCQISLYDFQKFLQMDQKESWASDLSRVREFLLGYMKGAPQP
EPTLQLDEFLAFLFSKENSVCNPRLSPVNPDEMKRPLSQYWISSSHNTYLTGDQFSSESS
LEAYARCLRMGCRCIELDCWDGPEDLPIIYHGHTLTSKIKFLDVLHTIKEHAFVTSEYPV
ILSIEDHCSVVQQRNMATNFKKVFGDLLLTKPVDNNADELPSPYQLRRKILIKHKKLVEG
TLYEEVMSASYSENDISNSLKNGILYLEDPIDHTWTPHYFVLTSNKIYYSEETSHYQTAD
EEEDDEGKEECNNNEQHCAERWFHGKLGGGRDGRQVAEKLLQDYCEGGGKDGTFLVRESE
TFVGDYTLSFWRSGRVQHCRIHSRQESGSTRFYLTDNLVFDSLYRLICHYRDTPLRCNEF
EMRLGNPVPQPNAHESREWYHSSLSRVQAEHMLMRVPRDGAFLVRKRSEHNSYAISFRAE
GKIKHCRIQQEGRLFMLGSSAEFESLVDLVSYYEKHPLYRKMRLRYPINEDTLDRMGTTE
LDYGALYEVRTPHFYVEANKMPTARCTVKALYDYRAQREDELCFPKQALILNVDKQEGGW
WRGDYGGKKQLWFPANYVEEVPTSPTRELDENSPLGNLLKGFIDVPTCHVVVHKDGKNLR
PFVFTIHSQNMSSHPVQTLDVAADTLEDLSSWVGKIKEATQNADARMQEEKQMERRKKIA
VELSDLVVYCRPVPFNEDKIGTERACYRDMSSFPETKAEKFATRGRGKRFLQYNRRQLSR
VYPRGQRLDSSNYDPLPMWLCGSQLVALNFQTPDKPMQLNQALFMLGGGSGYVPQPDIMR
DDAFDPFDKDTLHVEPITIQIQVLGARHLPKNGRSIVCPFVEMEICGADYDCCKFKTDVV
ADNGLNPVWLQKQFVFDIHNPTFSFLRFTVYEEDMFSDPNFLAQATYPVRLLRTGYRSVP
LKNSYSEELELASLLVHIEIVNAKEEDDENLYTSIQRLRDRTSELSTQVSLLERAGSADL
SYQQSLEELRAAQDQLSELVEARNRRLTEKKRREKLRQQVAAKRS
NT seq 3918 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgccaggttcagcggctgcctcaatggctctgcagaggaggccagctgtagt
gccaatgctccggtcataacctccagaatgctggactggacaggggccgggccccgcatc
ctccacaccctggagatgggcatgggcctaacggtcttctaccagaagaagtcccagcga
cctgagaggagaaccttccatatccggcaggacaccaggcagatagtgtggtgtcgaaac
cgggacaaaatagaaggagaggtggacatacgggagattcgagagctgcggttggggaag
ggctccagagacttcgagcgctacccagaggaggctcgtaaattggaccccaccctttgc
ttcatcgttctctacggtgtggagtttcgcctgcggaccctttgtgtggctgcttacagt
gaggaggaggtcaacatgtggatctctggactcaactggatgatgatggacaccaagaga
gcaccggccccacagcagattgacaggtggttgaggaaacagtttgaagtcatggacaga
agtcacgagggcagcatcactgtgaaggaagtcaaagctcttctgccccagatcaactac
agagtccctaatacacgttttctcaaagacaagttgcaggaggtggaggctagaagtgaa
ctgtcgtaccctaactttgcacagctgtacagaactctgatgtttgatgctcagaggagc
attattgagcagctggacctctcctttcccttgcgaaacgtcgaccggcctgagctttgt
cagatctccctttatgacttccagaagtttttacagatggaccagaaggagtcctgggcg
tcagacctgagtcgcgttagggagtttctactgggctacatgaagggagcaccgcaacct
gaacccacactacaactggatgagttcctggccttcttgttttccaaagagaattcggtt
tgtaacccacgtctttcacctgtcaatcccgatgagatgaaaagacctctctcccaatac
tggatttcctcctctcacaacacttacctgacaggtgaccagttttccagcgagtcatct
ctggaagcttacgcccgctgtctgaggatgggctgtcggtgcattgaattggactgctgg
gatggtcccgaggacctgccaatcatctaccacggccacactttgacctccaagatcaaa
ttcttggatgtgttgcacacaattaaggagcatgcctttgtcacgtctgagtatcctgtg
atcttgtccatcgaggaccactgcagtgtggtccaacagagaaacatggcaacaaacttc
aagaaagtctttggagatctgctgctcacaaagccggtcgacaacaacgcagatgagctc
ccgtctccgtaccagctgcgcaggaagattctcatcaagcacaagaaattggtggaagga
actttatatgaagaggtgatgtcagccagctactctgagaatgacatcagcaactccctg
aagaacggcatcctttacctggaggaccccatcgaccatacatggacgccacactatttt
gtcttgaccagtaataagatttactactcagaggagacgtctcattaccaaacagcggat
gaagaggaggatgatgaaggaaaagaggagtgcaacaacaacgagcagcactgtgcagag
cgctggttccacgggaagttaggtggagggcgggatggccggcaggtggctgagaagctc
ctgcaggactactgtgaaggcggaggaaaagacggcaccttcctggtgcgcgagagtgag
acttttgtgggagactacaccctttccttctggcgctccgggcgagtccagcactgcagg
atccactcacggcaggagtccggctccacccgcttctacctgacggacaacctggtgttt
gacagcctctaccgcctcatctgtcactacagagacacgccgctgcgctgcaacgagttt
gagatgaggctgggcaaccctgtgccacaacccaatgctcacgagagccgagagtggtac
cattccagtctgtcccgcgttcaggctgaacacatgctgatgcgtgtcccgagggacgga
gcttttttggtgcgcaaacgtagcgaacacaactcctacgccatctccttcagggcggaa
ggtaagatcaagcactgccgcatccagcaggagggtcggcttttcatgctgggaagctca
gccgagtttgagagtctggtggatcttgtgagctactatgagaagcatcctctgtaccgc
aagatgaggctccgctatcccatcaacgaggacactctggacaggatgggcaccacggaa
ctcgattatggagcgttgtatgaagtccgcacgcctcatttctacgtggaagccaataag
atgcccacagctcggtgcaccgtcaaagctctgtatgactacagagcacagagagaggac
gagctctgtttccccaaacaagcgctcatcctcaatgtggacaagcaggagggcggctgg
tggagaggtgactatggaggaaagaagcagctgtggtttcctgccaactacgtggaggag
gtgcccacctctcccaccagagaactggatgaaaacagtcctctgggtaacctcctgaag
ggcttcatcgatgtacccacctgccatgttgtggtccataaagacgggaagaacttgcgg
cccttcgtgttcaccattcactcccagaacatgtcctctcacccggtccagactctagac
gtggctgctgacaccctggaggatctctccagttgggttggcaaaatcaaggaggccacc
caaaatgctgatgctcggatgcaagaggagaaacagatggagaggagaaagaagattgca
gtggagctgtccgatctggtggtttactgcagacctgtccctttcaacgaggacaaaatt
gggacggagcgcgcctgttaccgggacatgtcctccttccctgagacaaaggcagagaag
tttgcgactcgaggtcgagggaagcgtttcctgcagtacaatcgccgccagctgtctaga
gtttaccccagagggcagagactggactcttcaaactacgacccacttcccatgtggctc
tgcggctcccagctggtggctctaaatttccagacaccagataaacccatgcagctgaac
caggctttgttcatgctgggaggtggcagcggctacgtccctcagcctgacatcatgagg
gacgacgccttcgaccctttcgacaaagacacgctgcatgtggagccaattaccatccag
atccaggtgcttggagcccgacatctccccaaaaacggccgcagcatcgtgtgtcctttt
gtggaaatggagatctgtggagccgattacgactgctgcaagttcaagactgatgttgtc
gctgataacggcctgaatccagtgtggctgcagaaacagtttgtgtttgacatccacaat
cccaccttctccttcctgcgcttcactgtgtacgaagaggacatgttcagcgaccccaac
tttctggcgcaggcgacgtacccagtccgcctgttgcgaacagggtacagaagtgttcct
ctgaaaaacagctacagtgaggagctggaattggcgtctcttttggttcatatagagatt
gtcaatgcaaaggaagaagacgatgagaacttgtatacatcaatccagcggcttcgggat
cgaaccagcgagctgtccacccaggtgtctctcctggagagggcaggctctgcagacctt
agctaccagcagagtctggaagagctgcgagctgctcaggaccagctgagcgagctggtg
gaggctcgcaaccgcaggctgacagagaagaagaggagggagaagctgaggcagcaggtg
gcggcaaagcgaagctag

DBGET integrated database retrieval system