KEGG   Oryzias latipes (Japanese medaka): 101168475Help
Entry
101168475         CDS       T02443                                 

Definition
general transcription factor 3C polypeptide 4-like
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101168475
Transcription machinery [BR:ola03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     101168475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 776 aa AA seqDB search
MAAASLPKAAKDEPQIMIKTEPEYADNHDLLTAGHVPTKRDPVVPLTSPVSGQQPLAWSP
DHRLSVCTASSLSVMEQLCDVHSNKQHLMLLRTSIPVPAEPVKMRVGPSAELAEAMKKFS
THPDLTLRQAFLTDRVIHPSVGSHKGIKYASWSPLGCDATGRCLLACLTLENRLTIHHNS
KRLEWNLLVDLTQKYGELLIERGYAKKDRPTEANLLDFEEFQRRFRMQTPVRMEWSSTYT
FKQVQPDNTCVDVEMVLLAVLMENGDLVLWKFLLPFTDGEDVLFLDLIESGVTRPSDLAW
WEYKYEDRQMSGLIIGSEEGPLKIFPVPLKSVKGYFTLRHPVILWKECDNIAVDNIRCVP
LMHPVHKASCSLIVASRGCYIFWCLLVVSTAGMNVFNSHIAGLHSLSVVSLTVDRQSMDF
YCCSMDGWIKKLTPMFQGNSLTFKQEDMPRLENLTGRRIHGIAVSPNGAYIALLSTQGFV
GKHHPINRTYQVHFVTLKSAEAATELLLKSPSQNLYKMMDLLDLVRWHVLKSSCIPMWLQ
EALDQKLQEADVPYLWRFQLFLVRVLYQTVQSPRGSNIWKPQPREAQIAEGNAEEGVREE
GEAAQTGACECGPVKQVKEEEQRATLQASIHAAEAHLLRENMKKVLGVVYLNTSVGQNTS
IPTCGLMEYLSRGVNDRASEVLIGHIKNKMNKQAFSERCALCQAVLPFTDHKDATCGNGH
LWHRCVLSYQACQTLTFRRCLLLDSIARLPEPEDPEWIKKILQAPCMLCDSPLMEN
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgcctctctgcccaaagcagcaaaagatgaaccccaaattatgatcaaaact
gaaccagaatacgcggataatcatgatttactcactgctgggcacgtcccaactaagcga
gacccggtagtccctctgacgtcgccggtaagtgggcagcagcccctcgcctggtcgccg
gatcaccgcctgtcagtgtgtaccgccagttccctgtcggtgatggagcagctgtgtgat
gttcacagcaacaaacagcatctgatgctgctccggacgtccatccctgtcccggccgag
ccagtcaaaatgcgggtgggaccatcagcagagctggctgaagcgatgaagaagttctcc
actcaccctgacctcacactgaggcaggcatttctgaccgacagagtgatccatccgtcg
gttggctcccacaaaggaataaagtatgcaagttggtcgcctttaggttgtgacgccacc
ggacgctgtctccttgcttgtttaacacttgaaaacaggcttaccatccatcataacagt
aagcgcctagagtggaacttgctggtcgatctcacccaaaagtacggtgagctgctgata
gagcgaggctacgccaagaaagacaggccgaccgaggccaacctgttggactttgaggag
tttcagcggcgtttccgcatgcagacgcctgtgaggatggagtggtcaagcacgtacacg
ttcaagcaggttcaaccggataacacctgcgtggatgtggagatggtcctcctcgccgtg
ttgatggaaaacggtgaccttgttttgtggaaattcttgctgccctttacggatggcgag
gatgtgttgtttttggacctcattgagtccggcgtgacgcggcccagtgacttggcgtgg
tgggagtacaaatatgaggatcgtcagatgagcggactgatcattggcagcgaggaaggg
cctcttaagatctttcccgtcccccttaaaagcgtgaaaggctacttcaccctcagacac
ccagtcatcctgtggaaagaatgtgacaatatcgcagttgacaacatccggtgcgttccg
ctgatgcatccggtccataaagctagctgcagcctgatcgtggcgtctcgaggctgctac
attttctggtgtttgcttgtggtttcaaccgccgggatgaatgtgttcaactctcacata
gcaggactccactcgctctctgtggtgtctctgacggtcgatcgacagagcatggacttc
tactgctgttccatggatggctggattaaaaaactgaccccgatgtttcaggggaactct
ctgacgttcaagcaggaagacatgccgcgacttgagaacctcaccggcagacggatccac
gggatagcggtgagccccaacggagcatacattgctcttcttagcacccagggtttcgtt
ggtaaacatcaccccatcaacaggacttaccaggtccactttgtgactctgaaatcagca
gaggctgctacagagctgctgttaaagtccccctctcagaacttgtataaaatgatggac
ctgctggacttggtgaggtggcacgttctcaaaagcagttgcattcccatgtggctgcaa
gaggcgctggatcagaaactccaggaggcagatgtaccctacttgtggcgcttccagctc
ttcttggtacgtgtattgtaccagacggtacaatctcctcgtggcagtaatatctggaaa
cctcaacccagggaagcccagatcgctgaaggaaatgcggaggaaggcgtcagagaagag
ggtgaggctgcgcaaacaggagcatgtgagtgtggaccagtcaaacaggtgaaggaggag
gagcagagggctacgctgcaggccagcatccacgcagccgaggcccacctgttgagggag
aatatgaagaaagtgttgggggtggtgtacctcaacacctccgtcggacaaaacaccagc
atccccacctgcggcctgatggagtatctttctagaggtgtgaacgaccgagcgtcagag
gtgctgatcggccacatcaagaataaaatgaataagcaggcgttctctgagcgctgcgcc
ctctgtcaggccgtgctgcccttcaccgaccacaaagacgccacgtgtggaaatggacac
ttgtggcacaggtgtgtgttgtcataccaggcctgccaaacgctgacgttcagacgctgc
ctcctgctggatagcatcgccagactgccagagcctgaggatccagagtggataaagaag
atcctgcaggcgccctgcatgctctgtgattcaccgctgatggagaactga

DBGET integrated database retrieval system