KEGG   Oryzias latipes (Japanese medaka): 101168630Help
Entry
101168630         CDS       T02443                                 

Definition
histone-lysine N-methyltransferase SETD7-like
Orthology
K11431  
histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101168630
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    101168630
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101168630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 371 aa AA seqDB search
MESDEENEEEVVVGPLDDDGLPHGFCTVTYSSSDRFEGHFTHGEKNGKGKFFFFDGSTLE
GYYVDDALQGQGVYTYEDGGVLNGMYVDGELNGPAQEFDSEGHLSFNGQYKDDARCGECW
IYYPDGGCVFGEVNEEGEMTGKSMAYIYPDGCTALYGSFVDGEIIEARSATMISKDHGRP
RFEVAPNSPVYSYDKSTSTCIATHTLLPDPYESQRVFVADSKIKGAGQGLFAKKDSEPGT
VMAFYNGVRITHSEVDSRDWALNGNTISLDEDTVIDVPKPFDQTERYCASLGHKANHSFT
PNCKYDPFVHPRFGQIKCIRTLRAVQKEEELTVAYGYDHKPTGQNDPEAPDWYKQELEAF
QQQQHHPPAGQ
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgacgaagagaatgaagaggaggtggtggtaggaccactggatgacgacggt
ctgcctcacggattctgcaccgtaacgtactcatccagcgatcgctttgagggacacttc
acccacggagagaagaatggcaagggcaagttcttcttctttgacggaagtaccttggaa
ggctactatgtggatgacgccctgcagggtcagggggtgtacacctatgaagacggaggg
gtcctcaatggaatgtacgttgacggcgagctcaacggacctgctcaggagtttgacagt
gagggtcatctgtcgtttaacggccagtacaaagacgacgcccgctgtggagagtgttgg
atctactaccccgacggaggctgtgtgtttggggaggtgaacgaggaaggggagatgacc
ggaaagtccatggcgtacatctaccctgatggatgcaccgctctttatggaagctttgtg
gatggggagatcatcgaagcccgatccgccacaatgatctccaaagaccacggaaggcct
cgctttgaagttgcccccaacagtcccgtgtactcgtatgataagtctacgtctacctgc
attgccacccacactctcctcccagacccatacgagagccaaagggtgtttgtggccgat
tcgaagatcaaaggagcagggcagggcctcttcgccaagaaggactcggagcctggtacc
gtcatggccttttacaacggggttcgcatcacccactccgaggtggacagccgggactgg
gccctcaacgggaacacgatctccctggatgaagacaccgtcattgatgtgccaaagccg
ttcgatcagaccgagagatactgcgcttctttgggtcacaaggccaaccactcctttacg
cccaactgcaaatacgacccttttgttcatccccgctttggacaaatcaagtgcatccgg
acactgagagctgtgcagaaggaggaggagctcacggttgcctacggttacgaccataag
cccacaggtcagaatgacccagaggctcccgactggtacaagcaagagctggaggcgttc
cagcagcagcagcatcatcctcctgctggacagtaa

DBGET integrated database retrieval system