KEGG   Oryzias latipes (Japanese medaka): 101168861Help
Entry
101168861         CDS       T02443                                 

Definition
protein-arginine deiminase type-2-like
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     101168861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 689 aa AA seqDB search
MFKQVDKAAPPAAPREHHRTCRLDVSKSQHVLYVVGTSLDVSIYRSAPPSSKFFSVKCTP
QVNCSISPPTPETSHQSQIPLNSNTSLLISMDRASEFENESKLSVRYYNEDSNAVGVAVL
HLTAVEISLDVDADRDGIVEENNPNKXXWKWGPNGYGAILLVNCDSETTKRSLKKPDCML
DYIRNVSDLKDMSPMKLRTRGPSRLPKGYKLMMHICLGDSEKIRVFGSKSGNKQVNNAGE
LDTNTVKDYPVVLGPEVLSQEVPYPGGDAEMDFHVEGLEFPDKDFDGLVTINLSLLKPIS
DAVPETPIFTDKVMFRVAPWIMTPNTLQPEEVFVCRTSDNQPFLKEIKDLVTKSGYKLKI
CEPFMNRGDRWIQDELEFGFVDSPHHQFPVVLDSPRDGELKNFPCKVLLGPDFGYVTREP
QSDEVSTMDSFGNLEVSPPVTVNGKKYPLGRIIIGVAFPTAKNGRNMTKVVQDFLWAQRV
QKPIALFSDWLVVGHVDEFMTFVPAPDRKGFRLLLASPDAAYKLFKDLKNNGHGQARMFD
GFPKERQITVEEILGDRVLLNHNNYVQSCIDWNRDVLKKELGLDDDDIIDLPILFKLEKK
NDGRVVAFYPDMVNMIVLGKNLGIPKPFGPKVNGRCALETEMCSLMGGLGLNCTFIDDYY
SYHKNLGEVHCGSNVRRKPFRFQWWNMEL
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagcaagttgataaagccgcaccacccgctgctccacgggaacatcatcggaca
tgtcgtctggacgtcagcaaatcgcagcatgtcctgtatgttgttggcacttctttggat
gtgagcatctacaggagtgcccctcccagctccaagttcttttctgtaaaatgcactccc
caggttaattgcagcatcagcccaccaactccagaaacctcccatcagtctcaaattcct
cttaacagtaataccagtcttctcatcagcatggaccgtgctagtgaatttgaaaatgaa
tccaagctgtcagtgcgctattacaacgaggacagtaatgctgttggagtagcagttctg
catttaacagctgttgagatttctctggatgtggatgctgacagggatggcattgtggag
gaaaacaaccccaataagnnnnnatggaagtggggtcctaatgggtatggagccatcctt
ttggtcaactgtgactcagagacaaccaaacgctctttgaaaaagccagactgcatgctg
gactacatccgcaatgtctcagatcttaaggacatgtcacccatgaagctgcgaactaga
ggtccttctcgtctccccaagggctacaaactgatgatgcacatctgtttaggagattca
gagaaaatccgtgtctttggatccaaatctggcaataaacaggttaacaatgcaggtgag
ctggacaccaacactgtgaaagactatccagtagttctgggccctgaggtcctttctcag
gaggtgccttaccctggaggcgatgcagagatggacttccatgtggaaggtctcgagttt
cctgacaaagactttgatgggctcgtcaccattaatctcagtctgctaaagccaattagt
gatgcggttcctgagactcccattttcacagacaaagtgatgttcagagtggccccatgg
atcatgacacccaacaccctccagcctgaggaggtgtttgtctgccgcacatctgataac
caaccgttcctgaaagagattaaagatctagttacaaagagcggctacaagctgaaaatt
tgtgaaccattcatgaatagaggagaccgctggatccaagatgagttagagtttggattt
gttgattcacctcatcatcagtttcctgttgttctggactccccaagagacggggaactc
aaaaactttccatgtaaagtactactggggcctgactttggctacgtgacacgtgaacct
caaagtgatgaggtgagcacgatggactcgtttggaaatctggaggtgagcccccctgtc
actgtgaacggaaaaaaataccctctgggcagaatcatcatcggggttgctttcccaacg
gcaaaaaatggacgaaacatgaccaaagtggttcaggacttcctgtgggctcaaagggtc
caaaagcccatcgccttgttttctgactggcttgttgttgggcatgtagacgagttcatg
acttttgtacctgcacctgacagaaagggcttccggctgctacttgcgagcccagatgca
gcctacaaattattcaaagacttgaagaacaatggacacggacaagccaggatgtttgat
gggttcccaaaagaacgacaaataacagtggaggaaatccttggtgatcgtgttttgcta
aatcataataactacgttcagagctgcatcgactggaacagagatgtattaaagaaggaa
ctgggcctggatgatgatgacatcattgacctgccaattctctttaagttggagaagaaa
aatgatgggagagtggtggcgttttatcctgacatggtcaacatgattgttctggggaaa
aacctgggcatccccaagccgtttggccctaaagtgaacggacgctgcgcactggagaca
gagatgtgttccctgatggggggcctgggcctcaactgcacattcattgacgactactac
tcttaccacaaaaaccttggagaggtgcactgtggctccaacgtccgcaggaaacccttt
cgcttccagtggtggaatatggagctttga

DBGET integrated database retrieval system