KEGG   Oryzias latipes (Japanese medaka): 101168870Help
Entry
101168870         CDS       T02443                                 

Definition
histone acetyltransferase p300-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101168870
   04330 Notch signaling pathway
    101168870
   04350 TGF-beta signaling pathway
    101168870
   04630 Jak-STAT signaling pathway
    101168870
   04068 FoxO signaling pathway
    101168870
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101168870
  Cellular commiunity
   04520 Adherens junction
    101168870
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101168870
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101168870
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101168870
Transcription factors [BR:ola03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101168870
Mitochondrial biogenesis [BR:ola03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101168870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 2662 aa AA seqDB search
MADNVLESGPPSAKRPKLSSPALSVSASDGNDFGSLFDLEHDLPDELINSSDLGLTNGGD
ASQLHTSLGGLGVGIGGSGQDAAAKHKQLSELLRAGAPAQQGGPTSSSAPSGPSMAMMGN
INVSSSGPQGMHPQGQQQQPGLTQQVGMVGGVQALSRAAALMGAQNGNTGQQHQGLMGAQ
VLNGSPRMGFLGNAGMGTSGNLLTENLQQQQGGQSVGGGVQPGMRPQQPGALNKMSMMAN
AGPYGGPYSQSAGQGLAGAGLGPQLQNKAVLPSNVAPQFSMDKKALPGQLSAAVGGPQVG
LAAVGAGPSTTPPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNV
LNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQSLLNSAAM
GLVNALGSGVPVGQSSTPNLNPTNQIDPSSIERGYAALGLTYQGNQMPQQLPQTNMPNQG
LQGQPGMRTLNTMGGNPMGVNGGVEVQTPNQQPALLPDAIMHNNMTAQSLMNDSVGNLGS
LPAAAPPSAAGMRKSWHEDITQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKV
EGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQGMMPGQPGIAPSGLPQGPPS
MGQPPMPPGQPLNGPHTDPSMVRPTGPNQMVNRMPHSAGMNQFGQMGMQTMSQRLTPPLP
HNPQMNQTTMGVKRMGQPNATQLQNQYLPPGQFPSSGPGLGSGPVGMNQPGTQTAVPSQN
QMSTPPSLPASSPAPQSASSAPGSGAPGGALGPTNSSSAGPLTSLPPSSTQPSSFPHCPP
VRTSSPSPARSLTPQPHQTPPMLPRSQTPQPQTPSTPQVPPPQHSQQQQLPSTQSATSEK
ASQPLQQTHGASPAPQAGQSSTVPAQNAHVPLQRPQTPLSPKPSLTADGHVSSPASVASA
NDPTSQLAAVEGPALSLDNVKMEVKKEEEEDEGAEGQGDGKGHIERGSSEVKAEEKPEIK
KEKPSGDGCKGEPMDTSSSSESSAGASEDKKPVVKKEPKEEEEGSTTTNSSPATAQSKKK
IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLD
TGQYQEPWQYIEDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFETEIDPVMQGLGYCCGRK
FEFSPQTLCCYGKQLCTIQRDAAYFSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTSIN
KDQFQRKKNDTLDPELLVECIDCGRKMHQICVLHNETIWPSGFVCDNCLKRANKSRKENK
YAAKRLPQTKLGNFLETRVNDYLKRQNHLESGEVTIRVVHVSDKVVEVKPGMKSRFVDSG
EMSESFPYRMKALFAFEDIDGADVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFKPR
HLRTAVYHEILLGYLEYVKRQGFTAGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWY
KKMLDKAVSERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEER
KREENSTSSESTDPSKGDSKNAKKKNNKKTSKNKSSLSRANKKKPGMPSVSNDLSQKLYA
TMEKHKEVFFVIRLIAGPTANSLPPITDPDPLMACDLMDGRDAFLTLARDKHLEFSSLRR
SKWSSMCMLVELHNQSQDRFVYTCNECKRHVETRFHCTVCEDYDLCITCYNIKGHEHKMD
KLGLGLDDDGNNQAAAAAQNPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQ
HTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQHLQHRLQQAQ
MLRRRMATMQRAGQPAGAMPGGPVVGLPSPGNVTAPNTPTSGGTQPPTPQTPTQTMPAVQ
QQGLGPGSGAQQPQPGGMAPQHPLHQFQQMGGGGGGGGVMSSPQHQQQMLPQHPNNMQSY
ANRPPGSSPVHQSQGKPVLGSATPPQQQPGGVMPPGQQASNQPPGQPPMPPSGPPAAAVE
IALKIQQVAESQRKMALQRHAAGAGLMPHHQQAPGQQMNMGHLGAVGMVGPQGMPPQIQT
AAARAHMDQQQAAPPGMMASAGGHMQQAPQQGNLQQIQLGPQAQQRMGAPLQNPQQQQQQ
WAGQGMSPQQRQAMMTQMGHSAMMPTQQQPPHQPTPGHAALMNMAQQQQGAVGGVTGGVV
PGAAGVPGAAGGNIPQGALQELLRTLRSPSSPLQQQQVLNILRSNPQLMAAFIKQRAAKY
KGGQGGPGGPGGVPGGPVGNIAGGSQQGSMNPVGAGQQGMHMGGQGGTNVNMSPMAQLQQ
MGNLNGAQFRELLMRKQLQQQQQQQQQLQQQQLQHQFQQPQPPQGQGFIGQQGMQPPAVG
QGPPGGPPLQQPGGQPGQQAPSYPGSVAQQQATVALQQRLQHQHHLQMQQQQNAMGGDVG
PGGGSISGPQQAPQVPQPTQIGPPPSTAQARLQQTLHQRMFHQQQQQQQHLGPGGSPAQH
TNPMSPQQPQQVNQSPHPHLQGQGMSTSLANQVRSPQPSPRPQSQPPHSSPSPRMQPHPS
PLHISPQMQTGSPHPNHLNQHHPGMMAPQQPQPPAAQQNAMEPFGSDEMLSQLSSMAGLH
GPGGSGQDPMGPNIGHSSLDHM
NT seq 7989 nt NT seq  +upstreamnt  +downstreamnt
atggccgataatgtcctggagtccggcccgccttcagctaagaggcccaagctatcctct
ccagcgctgtctgtctctgccagtgatggaaacgattttggttccctctttgatctggag
catgacctcccagatgagctcatcaattcttcagacctggggttgacaaatggaggggat
gccagtcagctccataccagtcttggggggcttggagtcgggattggtgggagtggccag
gatgcggctgcgaaacacaaacagctgtctgagcttttgcgtgcgggagcaccggctcaa
cagggcggtcctacctccagcagtgcaccatctgggccctccatggcaatgatggggaac
ataaatgtttcttctagtggacctcaaggcatgcaccctcagggccagcagcaacaacct
ggattaacacagcaggttggaatggtgggaggcgtgcaggcgctcagtcgggcagctgcc
ttgatgggcgcccaaaacggcaacactggacagcaacatcaagggcttatgggagctcag
gttctgaacggctcgcctagaatgggcttcctcggaaatgctggtatgggtaccagtggt
aatctgttgacggagaatttgcagcagcaacaggggggtcagtcggtcggaggcggcgtt
caaccgggaatgagacctcagcagccgggagcgctaaacaagatgagcatgatggccaac
gcgggcccctatggtggtccgtacagccagtctgctggccaggggctggctggagccggg
ctgggcccacagctccagaataaagcagtcctgcccagcaacgttgccccccagttcagc
atggacaagaaagcccttcctggtcaactctcggcagcagtgggaggaccccaggtcggc
cttgcggctgtgggagcaggacccagcaccacgccccccaccgccgacccagagaagagg
aagctcatccagcagcagctcgtcctcctgctccacgcacacaagtgccagcgaagggag
caggccaacggtgaagtgcggcagtgtaacctgccccactgccgcaccatgaagaatgtg
ctgaaccacatgactcattgccaggctggcaaatcttgccaggtggcacattgtgcctcg
tccagacagatcatctcccattggaaaaactgcacacgacacgactgtcccgtatgcttg
ccgctgaaaaatgccggagacaagaggaaccagcagtctcttctcaacagtgcagcgatg
ggtttagtcaacgctttaggttcgggtgttccagttggacagtccagcactcctaacctg
aaccccaccaaccagattgaccccagctccatagagaggggctatgctgcactgggactc
acataccagggcaaccagatgccccagcagctcccccagactaacatgccgaaccaaggg
ctgcagggacagcctgggatgaggactttaaacaccatgggaggaaacccaatgggagta
aatggtggagttgaggtgcaaacccccaaccagcagcctgccctccttccagatgccatc
atgcacaacaacatgacagcacagagtttgatgaacgacagtgtggggaaccttggctcc
ctgcctgcagctgctcctccttctgctgctggaatgaggaagtcctggcatgaagacatc
acgcaagacctccgcagccatctcgtccacaagcttgtgcaggccatttttcccactcct
gacccagctgcactgaaagaccggcggatggagaaccttgtagcttacgctcgcaaagta
gagggggacatgtacgaatcagccaacagcagggcggagtactaccatctcctggcagaa
aaaatctacaaaatccaaaaggaattggaagaaaagaggaggacacgactccagaagcag
ggcatgatgcctggccaacctggcattgccccctctggtcttccacaggggcctcctagc
atgggtcagccacccatgcctcctggacaacctctcaatggtcctcacactgatccgtcc
atggtccgacccaccggtccaaaccagatggtcaacaggatgccgcattcagcaggaatg
aaccagtttggtcagatggggatgcagacgatgagtcagaggttgacgcctccccttcct
cataatcctcaaatgaaccagacgacgatgggggtaaaaaggatgggtcaacccaatgcc
acccaactgcagaaccagtacctccctccaggccagtttcccagctctggtcctgggctt
gggtctggtcctgttggcatgaaccagccaggaacacagactgctgtgccttcacagaac
cagatgtcaacgccaccttctctcccagcgagcagccccgcaccacagtccgcctcttct
gccccaggatctggagctcccgggggagctttgggtcctactaactccagcagtgctgga
cctctcaccagtcttccaccctcctccacgcagccaagctccttcccccactgccctccg
gttagaacaagctccccctcaccagcacgcagcttaacacctcagccgcatcagacgccg
cccatgttgcctcgctcgcagaccccgcagccgcagacccccagcacacctcaagtgccc
cctccacagcattcacagcagcaacagctgccgtcaacgcagagcgcaacctccgaaaaa
gccagtcagcctttgcagcagactcacggggcctccccggctcctcaagcaggtcagagc
tctacggtcccggcacagaacgcgcacgttccactgcagcggccacagacccctctctcg
ccaaagccttctctaacggcagacggacacgtttcttctcctgcgtcggtcgcaagcgcc
aacgatcccacatcccagctcgccgctgtcgagggccctgctctcagcctggacaatgtc
aaaatggaagtgaaaaaggaggaggaggaagatgaaggagcagaagggcagggcgatggc
aaaggacatattgaaaggggttcatcagaggtgaaggcagaggaaaagccagagattaag
aaagagaagccatctggagatgggtgtaaaggcgagcccatggatacctcttcttcctct
gagtcatctgcaggagcaagtgaggacaaaaagccagtggtgaagaaagagcctaaagag
gaagaggaggggtcaacgaccaccaacagctccccagccactgctcagagcaagaagaaa
atctttaagccggaggagctgcgtcaggctctgatgccaaccctggaggctttgtaccgc
caggacccagagtctcttcccttccgccagccggtggacccccagttattaggaatacct
gactactttgacatcgtgaagaaccccatggatctgtccaccattaagaggaagctggac
acgggacagtaccaggagccgtggcagtacattgaggacgtgtggttgatgttcaacaac
gcctggctgtacaacagaaagacgtcgcgggtctacaagtactgctccaagttggctgag
gtgtttgagacggaaatcgaccccgtcatgcaaggcctggggtactgctgtgggaggaag
tttgagttttcgccacaaactctgtgctgctatgggaaacagttgtgcaccatccagcgg
gacgctgcgtacttcagctaccagaacaggtaccacttctgtgagaagtgtttcaacgaa
atccaaggcgagagtgtgtcgttgggggacgacccctcccagcctcagacgtctatcaac
aaagaccagttccagagaaagaagaatgacactctggaccctgagctacttgtggaatgt
attgactgcggtcgtaaaatgcaccagatctgcgtcctgcataacgaaaccatatggccg
tcgggctttgtgtgcgacaactgcctgaaaagagccaataagtcacggaaggagaacaaa
tacgccgctaagagacttcctcagaccaagttggggaactttttagagactcgagtgaac
gactacctcaaacggcagaaccacctggagtctggagaggtcaccatccgagttgtccac
gtctctgataaagtggttgaagtcaaaccaggcatgaagtccaggtttgtggacagcgga
gaaatgtccgagtcgttcccgtacaggatgaaggccctgtttgcctttgaggacattgac
ggggcggacgtgtgcttcttcggcatgcacgttcaagagtacggctcagactgcccccct
ccaaaccagaggcgggtgtacatctcctacctggacagcgtgcacttcttcaaacctcga
cacctcaggacagcagtgtatcacgagatcctactaggctatctggagtacgtcaagagg
caggggtttacagcgggacacatctgggcctgtcctcccagtgaaggagatgattatatc
tttcactgtcacccgccagaccagaagatccccaaacccaaacgcctgcaggagtggtac
aagaaaatgctggacaaggccgtctctgagcggatcatccatgactacaaggacattttc
aaacaagcaacagaagaccgactgacaagtgccaaggagctgccatactttgagggagac
ttctggcccaacgtgcttgaggagagcatcaaggagctggaacaggaggaggaggagagg
aagagggaggagaacagcacctccagcgagagcacagatccctccaagggagacagcaaa
aatgccaaaaagaagaacaacaaaaagacgagcaagaacaaaagcagcctgagccgagcc
aataagaagaaacccgggatgcccagtgtctccaacgacctttcccagaagctctacgcc
accatggagaaacataaggaggttttctttgttatccgcctcattgccggccccacggcc
aactctctgcccccaatcactgacccggatcctctgatggcctgtgacctcatggacggc
cgcgatgcctttctaactctggccagggacaagcacctggagttcagctctctcaggagg
tccaagtggagctccatgtgtatgctggtggagctccacaaccagagccaggaccgcttt
gtttacacctgcaacgaatgcaaacgccatgtggagacccgcttccactgcacggtctgc
gaggactacgacctgtgcatcacctgctacaacatcaaaggccacgagcacaaaatggac
aagctggggctcggcctggatgacgacggcaacaaccaggctgcagccgctgctcagaac
cccggggactcgcggcgcctcagcatccagcgctgcatccagtctctggtccacgcgtgt
caatgccgcaacgccaactgctcgctgccgtcctgccagaagatgaagcgggttgttcag
cacaccaaaggctgcaaacgcaagaccaacgggggatgtcccatctgcaagcagctcatc
gctctgtgctgctaccacgccaaacactgccaggagaacaagtgtccggtccccttctgt
ctaaacatcaagcagaagcttcggcagcagcatctgcagcacagactccagcaggcccag
atgctgaggaggaggatggccaccatgcagagggcggggcagccagccggggccatgcca
ggaggacctgtggtaggacttccatcaccaggaaacgtcacagcacccaacactccaacg
tctgggggaacccaacccccgacacctcagaccccaactcagaccatgcctgcagtccag
cagcagggactgggtcctgggagcggagcacagcaaccacaaccaggaggaatggctcct
caacatcctctccatcagttccagcagatgggaggtggaggtggaggtgggggggtcatg
agctccccacagcatcagcagcagatgctccctcagcaccccaacaacatgcagtcatac
gccaacagaccaccaggctcctccccagtccaccagtcccaggggaagcctgttctgggc
tctgcaactcccccccagcagcagcctgggggtgtcatgcctccaggacaacaggcttcc
aaccagccaccaggtcagccaccgatgcccccctctggccccccagcggccgccgtagag
atagctctgaagatccagcaggtggctgaatctcaaagaaagatggcgctacagaggcac
gcagcaggtgcgggtttgatgccccaccaccaacaggctccagggcagcagatgaacatg
ggacatctgggagcagtggggatggttggacctcaggggatgcccccgcaaatccagaca
gcagcagctcgagcccacatggaccagcagcaagctgctcccccaggaatgatggccagc
gctggcggacacatgcagcaggcccctcagcaaggaaacctgcagcagatccagctcggc
ccgcaggcgcagcagaggatgggggctccgctccagaacccgcagcagcagcagcaacag
tgggccggtcagggcatgtccccccagcagaggcaagctatgatgacccagatgggccat
tcagccatgatgcccacccaacagcagcctccccatcaaccaactccaggccatgctgcc
ttgatgaatatggcgcagcagcagcagggtgccgttgggggggtcacaggtggtgtagtc
cccggagctgccggtgttcctggtgctgcaggtggaaacatcccacagggagctctgcag
gagcttttgcgcacactccgctcccccagctccccgctgcagcagcagcaggtgctgaac
atcctgcgctctaacccgcaactcatggctgctttcattaaacagagggctgccaaatac
aagggggggcaggggggtcctggtggaccaggaggagtcccaggaggaccggtgggtaac
attgcaggaggaagccagcagggcagcatgaatcctgtgggggccggtcagcagggaatg
cacatggggggtcaaggaggaacaaatgtcaacatgagccccatggctcagttgcagcag
atgggaaacctgaacggagcccagtttagagagttgctgatgagaaagcagctacagcag
cagcaacaacaacaacaacagctgcagcaacaacagctgcagcatcagttccaacagcca
cagcccccccaggggcagggcttcatagggcagcagggcatgcagcctccagcagtgggg
caggggcctcctggggggccaccccttcagcagcccggtggacagccgggtcagcaggca
ccaagttaccccggatcagtcgctcagcagcaggccacggttgcactgcagcagagactg
cagcaccagcaccacctccagatgcagcagcaacagaacgccatggggggtgatgtaggg
ccaggtggagggagtatcagtggtccgcagcaagcaccccaagtccctcaacccacccaa
attggacccccaccttcaaccgctcaagcccggcttcaacagactctgcaccaaaggatg
ttccatcagcagcagcagcagcagcagcatctcggcccgggagggtcaccggcccagcac
accaaccccatgagcccccagcagcctcaacaggtgaaccagtccccccacccgcacctg
cagggacagggcatgtccacatctctggccaaccaggtccggtccccacagccctcaccc
agacctcagtcccagccgcctcactccagcccgtccccacgcatgcagccacacccctcc
ccgcttcacatctccccccagatgcagacgggctctcctcatcccaaccacctgaaccag
caccatccaggaatgatggcacctcaacaaccacaaccgccagcagcccagcagaacgcc
atggagccgttcggctcggatgagatgctgtcccagctgagcagcatggctggtctgcac
gggccaggcggcagcggtcaggacccaatgggccccaacatcggccacagctccttagac
cacatgtag

DBGET integrated database retrieval system