KEGG   Oryzias latipes (Japanese medaka): 101168870Help
Entry
101168870         CDS       T02443                                 

Definition
(RefSeq) histone acetyltransferase p300-like
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101168870
   04330 Notch signaling pathway
    101168870
   04350 TGF-beta signaling pathway
    101168870
   04068 FoxO signaling pathway
    101168870
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101168870
  Cellular community - eukaryotes
   04520 Adherens junction
    101168870
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101168870
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101168870
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101168870
Transcription factors [BR:ola03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101168870
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101168870
Mitochondrial biogenesis [BR:ola03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101168870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
8
AA seq 2827 aa AA seqDB search
MADNVLESGPPSAKRPKLSSPALSVSASDGNDFGSLFDLEHDLPDELINSSDLGLTNGGD
ASQLHTSLGGLGVGIGGSGQDAAAKHKQLSELLRAGAPAQQGGPTSSSAPSGPSMAMMGN
INVSSSGPQGMHPQGQQQQPGLTQQVGMVGGVQALSRAAALMGAQNGNTGQQHQGLMGAQ
VLNGSPRMGFLGNAGMGTSGNLLTENLQQQQGGQSVGGGVQPGMRPQQPGALNKMSMMAN
AGPYGGPYSQSAGQGLAGAGLGPQLQNKAVLPSNVAPQFSMDKKALPGQVMPGMAPQQQQ
QPGGVTGGPIGAAAAVGGPQVGLAAVGAGPSTTPPTADPEKRKLIQQQLVLLLHAHKCQR
REQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPV
CLPLKNAGDKRNQQSLLNSAAMGLVNALGSGVPVGQSSTPNLNPTNQIDPSSIERGYAAL
GLTYQGNQMPQQLPQTNMPNQGLQGQPGMRTLNTMGGNPMGVNGGVEVQTPNQQPALLPD
AIMHNNMTAQSLMNDSVGNLGSLPAAAPPSAAGMRKSWHEDITQDLRSHLVHKLVQAIFP
TPDPAALKDRRMENLVAYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQ
KQGMMPGQPGIAPSGLPQGPPSMGQPPMPPGQPLNGPHTDPSMVRPTGPNQMVNRMPHSA
GMNQFGQMGMQTMSQRLTPPLPHNPQMNQTTMGVKRMGQPNATQLQNQYLPPGQFPSSGP
GLGSGPVGMNQPGTQTAVPSQNQMSTPPSLPASSPAPQSASSAPGSGAPGGALGPTNSSS
AGPLTSLPPSSTQPSSFPHCPPVRTSSPSPARSLTPQPHQTPPMLPRSQTPQPQTPSTPQ
VPPPQHSQQQQLPSTQSATSEKASQPLQQTHGASPAPQAGQSSTVPAQNAHVPLQRPQTP
LSPKPSLTADGHVSSPASVASANDPTSQLAAVEGPALSLDNVKMEVKKEEEEDEGAEGQG
DGKGHIERGSSEVKAEEKPEIKKEKPSGDGCKGEPMDTSSSSESSAGASEDKKPVVKKEP
KEEEEGSTTTNSSPATAQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLG
IPVRIRTSNKTNLDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYIEDVWLMFNNAWLYNRK
TSRVYKYCSKLAEVFETEIDPVMQGLGYCCGRKFEFSPQTLCCYGKQLCTIQRDAAYFSY
QNSSPKYGLLADRYHFCEKCFNEIQGESVSLGDDPSQPQTSINKDQFQRKKNDTLDPELL
VECIDCGRKMHQICVLHNETIWPSGFVCDNCLKRANKSRKENKYAAKRLPQTKLGNFLET
RVNDYLKRQNHLESGEVTIRVVHVSDKVVEVKPGMKSRFVDSGEMSESFPYRMKALFAFE
DIDGADVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFKPRHLRTAVYHEILLGYLEY
VKRQGFTAGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIIHDYK
DIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSSESTDPSKG
DSKNAKKKNNKKTSKNKSSLSRANKKKPGMPSVSNDLSQKLYATMEKHKEVFFVIRLIAG
PTANSLPPITDPDPLMACDLMDGRDAFLTLARDKHLEFSSLRRSKWSSMCMLVELHNQSQ
DRFVYTCNECKRHVETRFHCTVCEDYDLCITCYNIKGHEHKMDKLGLGLDDDGNNQAAAA
AQNPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICK
QLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQHLQHRLQQAQMLRRRMATMQRAGQPAG
AMPGGPVVGLPSPGNVTAPNTPTSGGTQPPTPQTPTQTMPAVQQQGLGPGSGAQQPQPGG
MAPQHPLHQFQQMGGGGGGGGVMSSPQHQQQMLPQVPQQQQQQQQQQQQQQQQQQQQQPG
SGTNPGQHPNNMQSYANRPPGSSPVHQSQGKPVLGSATPPQQQPGGVMPPGQQASNQPPG
QPPMPPSGPPAAAVEIALKIQQVAESQRKMALQRHAAGAGLMPHHQQAPGQQMNMGHLGA
VGMVGPQGMPPQIQTAAARAHMDQQQAAPPGMMASAGGHMQQAPQQGNLQQIQLGPQAQQ
RMGAPLQNPQQQQQQWAGQGMSPQQRQAMMTQMGHSAMMPTQQQPPHQPTPGHAALMNMA
QQQQGAVGGVTGGVVPGAAGVPGAAGGNIPQGALQELLRTLRSPSSPLQQQQVLNILRSN
PQLMAAFIKQRAAKYKGGQGGPGGPGGVPGGPVGNIAGGSQQGSMNPVGAGQQGMHMGGQ
GGTNVNMSPMAQLQQVQQQQQQQLQQLQQQQLQQQQRPMLSGLQQQQVAALQQQQQQQQQ
QQGVGRGMPGQGPQMGNLNGAQFRELLMRKQLQQQQQQQQQLQQQQLQQQQQQQQLQQQQ
QQQQQQQHQQQQQHMGVNHSQFQQPQPPQGQGFIGQQGMQPPAVGQGPPGGPPLQQPGGQ
PGQQAPSYPGSVAQQQATVALQQRLQHQHHLQMQQQQNAMGGDVGPGGGSISGPQQAPQV
PQPTQIGPPPSTAQARLQQTLHQRMFHQQQQQQQHLGPGGSPAQHTNPMSPQQPQQVNQS
PHPHLQGQGMSTSLANQVRSPQPSPRPQSQPPHSSPSPRMQPHPSPLHISPQMQTGSPHP
NHLNQHHPGMMAPQQPQPPAAQQNAMEPFGSDEMLSQLSSMAGLHGPGGSGQDPMGPNIG
HSSLDHM
NT seq 8484 nt NT seq  +upstreamnt  +downstreamnt
atggccgataatgtcctggagtccggcccgccttcagctaagaggcccaagctatcctct
ccagcgctgtctgtctctgccagtgatggaaacgattttggttccctctttgatctggag
catgacctcccagatgagctcatcaattcttcagacctggggttgacaaatggaggggat
gccagtcagctccataccagtcttggggggcttggagtcgggattggtgggagtggccag
gatgcggctgcgaaacacaaacagctgtctgagcttttgcgtgcgggagcaccggctcaa
cagggcggtcctacctccagcagtgcaccatctgggccctccatggcaatgatggggaac
ataaatgtttcttctagtggacctcaaggcatgcaccctcagggccagcagcaacaacct
ggattaacacagcaggttggaatggtgggaggcgtgcaggcgctcagtcgggcagctgcc
ttgatgggcgcccaaaacggcaacactggacagcaacatcaagggcttatgggagctcag
gttctgaacggctcgcctagaatgggcttcctcggaaatgctggtatgggtaccagtggt
aatctgttgacggagaatttgcagcagcaacaggggggtcagtcggtcggaggcggcgtt
caaccgggaatgagacctcagcagccgggagcgctaaacaagatgagcatgatggccaac
gcgggcccctatggtggtccgtacagccagtctgctggccaggggctggctggagccggg
ctgggcccacagctccagaataaagcagtcctgcccagcaacgttgccccccagttcagc
atggacaagaaagcccttcctggtcaagtcatgcccgggatggctcctcagcagcagcag
cagcctggtggcgtcactggtggacccatcggtgcagcggcagcagtgggaggaccccag
gtcggccttgcggctgtgggagcaggacccagcaccacgccccccaccgccgacccagag
aagaggaagctcatccagcagcagctcgtcctcctgctccacgcacacaagtgccagcga
agggagcaggccaacggtgaagtgcggcagtgtaacctgccccactgccgcaccatgaag
aatgtgctgaaccacatgactcattgccaggctggcaaatcttgccaggtggcacattgt
gcctcgtccagacagatcatctcccattggaaaaactgcacacgacacgactgtcccgta
tgcttgccgctgaaaaatgccggagacaagaggaaccagcagtctcttctcaacagtgca
gcgatgggtttagtcaacgctttaggttcgggtgttccagttggacagtccagcactcct
aacctgaaccccaccaaccagattgaccccagctccatagagaggggctatgctgcactg
ggactcacataccagggcaaccagatgccccagcagctcccccagactaacatgccgaac
caagggctgcagggacagcctgggatgaggactttaaacaccatgggaggaaacccaatg
ggagtaaatggtggagttgaggtgcaaacccccaaccagcagcctgccctccttccagat
gccatcatgcacaacaacatgacagcacagagtttgatgaacgacagtgtggggaacctt
ggctccctgcctgcagctgctcctccttctgctgctggaatgaggaagtcctggcatgaa
gacatcacgcaagacctccgcagccatctcgtccacaagcttgtgcaggccatttttccc
actcctgacccagctgcactgaaagaccggcggatggagaaccttgtagcttacgctcgc
aaagtagagggggacatgtacgaatcagccaacagcagggcggagtactaccatctcctg
gcagaaaaaatctacaaaatccaaaaggaattggaagaaaagaggaggacacgactccag
aagcagggcatgatgcctggccaacctggcattgccccctctggtcttccacaggggcct
cctagcatgggtcagccacccatgcctcctggacaacctctcaatggtcctcacactgat
ccgtccatggtccgacccaccggtccaaaccagatggtcaacaggatgccgcattcagca
ggaatgaaccagtttggtcagatggggatgcagacgatgagtcagaggttgacgcctccc
cttcctcataatcctcaaatgaaccagacgacgatgggggtaaaaaggatgggtcaaccc
aatgccacccaactgcagaaccagtacctccctccaggccagtttcccagctctggtcct
gggcttgggtctggtcctgttggcatgaaccagccaggaacacagactgctgtgccttca
cagaaccagatgtcaacgccaccttctctcccagcgagcagccccgcaccacagtccgcc
tcttctgccccaggatctggagctcccgggggagctttgggtcctactaactccagcagt
gctggacctctcaccagtcttccaccctcctccacgcagccaagctccttcccccactgc
cctccggttagaacaagctccccctcaccagcacgcagcttaacacctcagccgcatcag
acgccgcccatgttgcctcgctcgcagaccccgcagccgcagacccccagcacacctcaa
gtgccccctccacagcattcacagcagcaacagctgccgtcaacgcagagcgcaacctcc
gaaaaagccagtcagcctttgcagcagactcacggggcctccccggctcctcaagcaggt
cagagctctacggtcccggcacagaacgcgcacgttccactgcagcggccacagacccct
ctctcgccaaagccttctctaacggcagacggacacgtttcttctcctgcgtcggtcgca
agcgccaacgatcccacatcccagctcgccgctgtcgagggccctgctctcagcctggac
aatgtcaaaatggaagtgaaaaaggaggaggaggaagatgaaggagcagaagggcagggc
gatggcaaaggacatattgaaaggggttcatcagaggtgaaggcagaggaaaagccagag
attaagaaagagaagccatctggagatgggtgtaaaggcgagcccatggatacctcttct
tcctctgagtcatctgcaggagcaagtgaggacaaaaagccagtggtgaagaaagagcct
aaagaggaagaggaggggtcaacgaccaccaacagctccccagccactgctcagagcaag
aagaaaatctttaagccggaggagctgcgtcaggctctgatgccaaccctggaggctttg
taccgccaggacccagagtctcttcccttccgccagccggtggacccccagttattagga
atacctgtacgtattcgaactagtaacaaaactaacctggactactttgacatcgtgaag
aaccccatggatctgtccaccattaagaggaagctggacacgggacagtaccaggagccg
tggcagtacattgaggacgtgtggttgatgttcaacaacgcctggctgtacaacagaaag
acgtcgcgggtctacaagtactgctccaagttggctgaggtgtttgagacggaaatcgac
cccgtcatgcaaggcctggggtactgctgtgggaggaagtttgagttttcgccacaaact
ctgtgctgctatgggaaacagttgtgcaccatccagcgggacgctgcgtacttcagctac
cagaacagttcaccaaaatatgggcttcttgctgacaggtaccacttctgtgagaagtgt
ttcaacgaaatccaaggcgagagtgtgtcgttgggggacgacccctcccagcctcagacg
tctatcaacaaagaccagttccagagaaagaagaatgacactctggaccctgagctactt
gtggaatgtattgactgcggtcgtaaaatgcaccagatctgcgtcctgcataacgaaacc
atatggccgtcgggctttgtgtgcgacaactgcctgaaaagagccaataagtcacggaag
gagaacaaatacgccgctaagagacttcctcagaccaagttggggaactttttagagact
cgagtgaacgactacctcaaacggcagaaccacctggagtctggagaggtcaccatccga
gttgtccacgtctctgataaagtggttgaagtcaaaccaggcatgaagtccaggtttgtg
gacagcggagaaatgtccgagtcgttcccgtacaggatgaaggccctgtttgcctttgag
gacattgacggggcggacgtgtgcttcttcggcatgcacgttcaagagtacggctcagac
tgcccccctccaaaccagaggcgggtgtacatctcctacctggacagcgtgcacttcttc
aaacctcgacacctcaggacagcagtgtatcacgagatcctactaggctatctggagtac
gtcaagaggcaggggtttacagcgggacacatctgggcctgtcctcccagtgaaggagat
gattatatctttcactgtcacccgccagaccagaagatccccaaacccaaacgcctgcag
gagtggtacaagaaaatgctggacaaggccgtctctgagcggatcatccatgactacaag
gacattttcaaacaagcaacagaagaccgactgacaagtgccaaggagctgccatacttt
gagggagacttctggcccaacgtgcttgaggagagcatcaaggagctggaacaggaggag
gaggagaggaagagggaggagaacagcacctccagcgagagcacagatccctccaaggga
gacagcaaaaatgccaaaaagaagaacaacaaaaagacgagcaagaacaaaagcagcctg
agccgagccaataagaagaaacccgggatgcccagtgtctccaacgacctttcccagaag
ctctacgccaccatggagaaacataaggaggttttctttgttatccgcctcattgccggc
cccacggccaactctctgcccccaatcactgacccggatcctctgatggcctgtgacctc
atggacggccgcgatgcctttctaactctggccagggacaagcacctggagttcagctct
ctcaggaggtccaagtggagctccatgtgtatgctggtggagctccacaaccagagccag
gaccgctttgtttacacctgcaacgaatgcaaacgccatgtggagacccgcttccactgc
acggtctgcgaggactacgacctgtgcatcacctgctacaacatcaaaggccacgagcac
aaaatggacaagctggggctcggcctggatgacgacggcaacaaccaggctgcagccgct
gctcagaaccccggggactcgcggcgcctcagcatccagcgctgcatccagtctctggtc
cacgcgtgtcaatgccgcaacgccaactgctcgctgccgtcctgccagaagatgaagcgg
gttgttcagcacaccaaaggctgcaaacgcaagaccaacgggggatgtcccatctgcaag
cagctcatcgctctgtgctgctaccacgccaaacactgccaggagaacaagtgtccggtc
cccttctgtctaaacatcaagcagaagcttcggcagcagcatctgcagcacagactccag
caggcccagatgctgaggaggaggatggccaccatgcagagggcggggcagccagccggg
gccatgccaggaggacctgtggtaggacttccatcaccaggaaacgtcacagcacccaac
actccaacgtctgggggaacccaacccccgacacctcagaccccaactcagaccatgcct
gcagtccagcagcagggactgggtcctgggagcggagcacagcaaccacaaccaggagga
atggctcctcaacatcctctccatcagttccagcagatgggaggtggaggtggaggtggg
ggggtcatgagctccccacagcatcagcagcagatgctccctcaggtcccacagcagcag
cagcagcagcagcagcagcaacaacaacaacaacaacaacaacaacaacaacaacctgga
tcaggaacaaatccggggcagcaccccaacaacatgcagtcatacgccaacagaccacca
ggctcctccccagtccaccagtcccaggggaagcctgttctgggctctgcaactcccccc
cagcagcagcctgggggtgtcatgcctccaggacaacaggcttccaaccagccaccaggt
cagccaccgatgcccccctctggccccccagcggccgccgtagagatagctctgaagatc
cagcaggtggctgaatctcaaagaaagatggcgctacagaggcacgcagcaggtgcgggt
ttgatgccccaccaccaacaggctccagggcagcagatgaacatgggacatctgggagca
gtggggatggttggacctcaggggatgcccccgcaaatccagacagcagcagctcgagcc
cacatggaccagcagcaagctgctcccccaggaatgatggccagcgctggcggacacatg
cagcaggcccctcagcaaggaaacctgcagcagatccagctcggcccgcaggcgcagcag
aggatgggggctccgctccagaacccgcagcagcagcagcaacagtgggccggtcagggc
atgtccccccagcagaggcaagctatgatgacccagatgggccattcagccatgatgccc
acccaacagcagcctccccatcaaccaactccaggccatgctgccttgatgaatatggcg
cagcagcagcagggtgccgttgggggggtcacaggtggtgtagtccccggagctgccggt
gttcctggtgctgcaggtggaaacatcccacagggagctctgcaggagcttttgcgcaca
ctccgctcccccagctccccgctgcagcagcagcaggtgctgaacatcctgcgctctaac
ccgcaactcatggctgctttcattaaacagagggctgccaaatacaagggggggcagggg
ggtcctggtggaccaggaggagtcccaggaggaccggtgggtaacattgcaggaggaagc
cagcagggcagcatgaatcctgtgggggccggtcagcagggaatgcacatggggggtcaa
ggaggaacaaatgtcaacatgagccccatggctcagttgcagcaggtccagcagcagcag
cagcagcagcttcagcagttgcagcagcagcagttgcagcagcagcagaggccaatgctc
agtgggttacagcagcagcaggttgcagctctccagcagcagcaacaacagcagcagcag
cagcaaggcgtgggtcgaggaatgccgggtcaggggccccagatgggaaacctgaacgga
gcccagtttagagagttgctgatgagaaagcagctacagcagcagcaacaacaacaacaa
cagctgcagcaacaacagctgcagcagcaacaacagcagcaacagctgcagcagcagcag
caacaacaacagcagcagcagcaccaacaacagcagcagcacatgggagtaaaccacagt
cagttccaacagccacagcccccccaggggcagggcttcatagggcagcagggcatgcag
cctccagcagtggggcaggggcctcctggggggccaccccttcagcagcccggtggacag
ccgggtcagcaggcaccaagttaccccggatcagtcgctcagcagcaggccacggttgca
ctgcagcagagactgcagcaccagcaccacctccagatgcagcagcaacagaacgccatg
gggggtgatgtagggccaggtggagggagtatcagtggtccgcagcaagcaccccaagtc
cctcaacccacccaaattggacccccaccttcaaccgctcaagcccggcttcaacagact
ctgcaccaaaggatgttccatcagcagcagcagcagcagcagcatctcggcccgggaggg
tcaccggcccagcacaccaaccccatgagcccccagcagcctcaacaggtgaaccagtcc
ccccacccgcacctgcagggacagggcatgtccacatctctggccaaccaggtccggtcc
ccacagccctcacccagacctcagtcccagccgcctcactccagcccgtccccacgcatg
cagccacacccctccccgcttcacatctccccccagatgcagacgggctctcctcatccc
aaccacctgaaccagcaccatccaggaatgatggcacctcaacaaccacaaccgccagca
gcccagcagaacgccatggagccgttcggctcggatgagatgctgtcccagctgagcagc
atggctggtctgcacgggccaggcggcagcggtcaggacccaatgggccccaacatcggc
cacagctccttagaccacatgtag

DBGET integrated database retrieval system