KEGG   Oryzias latipes (Japanese medaka): 101169044Help
Entry
101169044         CDS       T02443                                 

Definition
alpha-galactosidase A-like
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ola00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ola00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ola00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ola00603]
Cellular Processes; Transport and catabolism; Lysosome [PATH:ola04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 427 aa AA seqDB search
MASFGALLVVVGLMCPTAEALDNGLALKPTMGWLHWERFTCNTDCDTDPRNCISEQLYMQ
MADVMVKEGWKEAGYEYVCIDDCWPSHKRDAKGRLQADPNRFPGGIKKLADYIHSKGLKL
GIYADVGKNTCAGYPGSLGYYETDAQTFADWDVDLLKFDGCFMERTLIAEGYMNMSKALN
KTGRSILYSCEWPLYEWAIKQPNYTAIREYCNHWRNFNDIFDSWSSLKTILEWTASNQKI
IVPAAGPGGWNDPDMLVIGNFGLSHDQQQSQMALWAIMAAPLLMSNDLRDICPRSKELLQ
NRMIIAINQDPLGQQGYHTARLMDFDVWERPLFGNRLAIAIMNRQELGGPRRFPISAVPG
WKICVPQCNVTQILPQYKELGVQSHQKELVLSVNPTGTTLLTVTPLSSNLRKLHWNNTAV
QKEHTLL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggccagctttggcgctctgctcgtggtcgtgggtctgatgtgtcccaccgccgaagcg
ctggacaacggcctggcgctgaagcccaccatgggctggctgcactgggagaggttcacc
tgcaacacggactgtgacacagaccccaggaactgcatcagcgagcaactgtacatgcaa
atggcggatgtgatggtgaaggagggatggaaagaggccggttatgagtacgtctgcatt
gatgactgctggccctcccacaagcgcgacgctaagggccgcctgcaggccgaccccaac
agattcccaggaggcattaagaaactggccgactatatccattctaagggtttgaaacta
ggaatttatgcagatgtcgggaaaaatacatgcgctggataccccggcagtctgggttac
tatgaaacagatgctcagacgtttgcagactgggatgtggacctgctcaagtttgatgga
tgcttcatggaaaggaccctgattgcagaaggctatatgaacatgtcaaaggcactgaac
aaaactgggagaagcatcctgtactcctgtgagtggcctctgtacgaatgggccatcaaa
cagcctaactacaccgccattcgggaatactgtaatcactggcgtaacttcaacgacatc
tttgactcctggagctccctcaagaccatcttggagtggactgcttccaatcagaagatc
atcgtacctgcagctggacccgggggctggaatgaccccgacatgctcgtcatcggaaac
tttggtctgagtcacgaccagcagcagtctcaaatggcattatgggccatcatggcggct
cccctgctcatgtccaatgacctgcgagacatttgtcctcgatccaaggagctgctgcaa
aaccgcatgatcatcgccatcaatcaggacccactgggccagcagggataccacaccgca
cggctcatggactttgacgtctgggagagacctctgtttgggaaccgcctcgccatcgcc
atcatgaacaggcaggagctcggcgggccgcggaggtttcccatcagcgctgtccccggc
tggaagatctgtgtcccccaatgcaacgtcacccagatcctgccccagtacaaggagctg
ggagtccagtctcaccagaaagaactggttttgagcgtcaaccctacaggcaccactttg
ctgacggtcacgcccctcagcagtaacctcaggaagctgcactggaacaacacggcagtt
caaaaggagcacacccttctctag

DBGET integrated database retrieval system