KEGG   Oryzias latipes (Japanese medaka): 101169044Help
Entry
101169044         CDS       T02443                                 

Gene name
gla
Definition
(RefSeq) alpha-galactosidase A
  KO
K01189  alpha-galactosidase [EC:3.2.1.22]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00052  Galactose metabolism
ola00561  Glycerolipid metabolism
ola00600  Sphingolipid metabolism
ola00603  Glycosphingolipid biosynthesis - globo and isoglobo series
ola04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101169044 (gla)
  Lipid metabolism
   00561 Glycerolipid metabolism
    101169044 (gla)
   00600 Sphingolipid metabolism
    101169044 (gla)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    101169044 (gla)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101169044 (gla)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     101169044 (gla)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase
Motif
Other DBs
NCBI-GeneID: 101169044
NCBI-ProteinID: XP_004073084
Position
10
AA seq 427 aa AA seqDB search
MASFGALLVVVGLMCPTAEALDNGLALKPTMGWLHWERFTCNTDCDTDPRNCISEQLYMQ
MADVMVKEGWKEAGYEYVCIDDCWPSHKRDAKGRLQADPNRFPGGIKKLADYIHSKGLKL
GIYADVGKNTCAGYPGSLGYYETDAQTFADWDVDLLKFDGCFMERTLIAEGYMNMSKALN
KTGRSILYSCEWPLYEWAIKQPNYTAIREYCNHWRNFNDIFDSWSSLKTILEWTASNQKI
IVPAAGPGGWNDPDMLVIGNFGLSHDQQQSQMALWAIMAAPLLMSNDLRDICPRSKELLQ
NRMIIAINQDPLGQQGYHTARLMDFDVWERPLFGNRLAIAIMNRQELGGPRRFPISAVPG
WKICVPQCNVTQILPQYKELGVQSHQKELVLSVNPTGTTLLTVTPLSSNLRKLHWNNTAV
QKEHTLL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggccagctttggcgctctgctcgtggtcgtgggtctgatgtgtcccaccgccgaagcg
ctggacaacggcctggcgctgaagcccaccatgggctggctgcactgggagaggttcacc
tgcaacacggactgtgacacagaccccaggaactgcatcagcgagcaactgtacatgcaa
atggcggatgtgatggtgaaggagggatggaaagaggccggttatgagtacgtctgcatt
gatgactgctggccctcccacaagcgcgacgctaagggccgcctgcaggccgaccccaac
agattcccaggaggcattaagaaactggccgactatatccattctaagggtttgaaacta
ggaatttatgcagatgtcgggaaaaatacatgcgctggataccccggcagtctgggttac
tatgaaacagatgctcagacgtttgcagactgggatgtggacctgctcaagtttgatgga
tgcttcatggaaaggaccctgattgcagaaggctatatgaacatgtcaaaggcactgaac
aaaactgggagaagcatcctgtactcctgtgagtggcctctgtacgaatgggccatcaaa
cagcctaactacaccgccattcgggaatactgtaatcactggcgtaacttcaacgacatc
tttgactcctggagctccctcaagaccatcttggagtggactgcttccaatcagaagatc
atcgtacctgcagctggacccgggggctggaatgaccccgacatgctcgtcatcggaaac
tttggtctgagtcacgaccagcagcagtctcaaatggcattatgggccatcatggcggct
cccctgctcatgtccaatgacctgcgagacatttgtcctcgatccaaggagctgctgcaa
aaccgcatgatcatcgccatcaatcaggacccactgggccagcagggataccacaccgca
cggctcatggactttgacgtctgggagagacctctgtttgggaaccgcctcgccatcgcc
atcatgaacaggcaggagctcggcgggccgcggaggtttcccatcagcgctgtccccggc
tggaagatctgtgtcccccaatgcaacgtcacccagatcctgccccagtacaaggagctg
ggagtccagtctcaccagaaagaactggttttgagcgtcaaccctacaggcaccactttg
ctgacggtcacgcccctcagcagtaacctcaggaagctgcactggaacaacacggcagtt
caaaaggagcacacccttctctag

DBGET integrated database retrieval system