KEGG   Oryzias latipes (Japanese medaka): 101169044Help
Entry
101169044         CDS       T02443                                 

Definition
alpha-galactosidase A-like
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101169044
  Lipid metabolism
   00561 Glycerolipid metabolism
    101169044
   00600 Sphingolipid metabolism
    101169044
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    101169044
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101169044
Enzymes [BR:ola01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     101169044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 427 aa AA seqDB search
MASFGALLVVVGLMCPTAEALDNGLALKPTMGWLHWERFTCNTDCDTDPRNCISEQLYMQ
MADVMVKEGWKEAGYEYVCIDDCWPSHKRDAKGRLQADPNRFPGGIKKLADYIHSKGLKL
GIYADVGKNTCAGYPGSLGYYETDAQTFADWDVDLLKFDGCFMERTLIAEGYMNMSKALN
KTGRSILYSCEWPLYEWAIKQPNYTAIREYCNHWRNFNDIFDSWSSLKTILEWTASNQKI
IVPAAGPGGWNDPDMLVIGNFGLSHDQQQSQMALWAIMAAPLLMSNDLRDICPRSKELLQ
NRMIIAINQDPLGQQGYHTARLMDFDVWERPLFGNRLAIAIMNRQELGGPRRFPISAVPG
WKICVPQCNVTQILPQYKELGVQSHQKELVLSVNPTGTTLLTVTPLSSNLRKLHWNNTAV
QKEHTLL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggccagctttggcgctctgctcgtggtcgtgggtctgatgtgtcccaccgccgaagcg
ctggacaacggcctggcgctgaagcccaccatgggctggctgcactgggagaggttcacc
tgcaacacggactgtgacacagaccccaggaactgcatcagcgagcaactgtacatgcaa
atggcggatgtgatggtgaaggagggatggaaagaggccggttatgagtacgtctgcatt
gatgactgctggccctcccacaagcgcgacgctaagggccgcctgcaggccgaccccaac
agattcccaggaggcattaagaaactggccgactatatccattctaagggtttgaaacta
ggaatttatgcagatgtcgggaaaaatacatgcgctggataccccggcagtctgggttac
tatgaaacagatgctcagacgtttgcagactgggatgtggacctgctcaagtttgatgga
tgcttcatggaaaggaccctgattgcagaaggctatatgaacatgtcaaaggcactgaac
aaaactgggagaagcatcctgtactcctgtgagtggcctctgtacgaatgggccatcaaa
cagcctaactacaccgccattcgggaatactgtaatcactggcgtaacttcaacgacatc
tttgactcctggagctccctcaagaccatcttggagtggactgcttccaatcagaagatc
atcgtacctgcagctggacccgggggctggaatgaccccgacatgctcgtcatcggaaac
tttggtctgagtcacgaccagcagcagtctcaaatggcattatgggccatcatggcggct
cccctgctcatgtccaatgacctgcgagacatttgtcctcgatccaaggagctgctgcaa
aaccgcatgatcatcgccatcaatcaggacccactgggccagcagggataccacaccgca
cggctcatggactttgacgtctgggagagacctctgtttgggaaccgcctcgccatcgcc
atcatgaacaggcaggagctcggcgggccgcggaggtttcccatcagcgctgtccccggc
tggaagatctgtgtcccccaatgcaacgtcacccagatcctgccccagtacaaggagctg
ggagtccagtctcaccagaaagaactggttttgagcgtcaaccctacaggcaccactttg
ctgacggtcacgcccctcagcagtaacctcaggaagctgcactggaacaacacggcagtt
caaaaggagcacacccttctctag

DBGET integrated database retrieval system