KEGG   Oryzias latipes (Japanese medaka): 101169240Help
Entry
101169240         CDS       T02443                                 

Definition
(RefSeq) delta-1-pyrroline-5-carboxylate synthase
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00330  Arginine and proline metabolism
ola01100  Metabolic pathways
ola01230  Biosynthesis of amino acids
Module
ola_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    101169240
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     101169240
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     101169240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase Aldedh
Motif
Other DBs
NCBI-GeneID: 101169240
NCBI-ProteinID: XP_023805577
Position
19
AA seq 697 aa AA seqDB search
MLQNHGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALQSGHNQPKDMSLPALEARACAA
AGQSGLMALYEAMFSQYSTCTAQVLVTNLDFHDDEKRQNLHSTLQELLRMNIVPIINTND
AVVPPPEPNSDLHGVISIKDNDSLAARLAVEMKADLLIALSDVEGLYNSPPGTDDAKLID
IFYPGDQHSITFGTKSRVGLGGMEAKVKAALWALQGGTSVVIANGTNPKVTGHVITDIVE
GKKVGTFFSETKPAGPSVEEQTEMARSSGRILASLQAEKRSEIICRLADLLTEKTEEILA
ANKLDLEVASSSGRLPSAMLKRLSLSVAKINSLSIGLRQIATSAQNSAGRVLRRTRVAHN
LELEQITVPIGVVLVIFEARPDCLPQVSALAIASGNALLLKGGKEAANTNHVLLQLTQEA
LSMHGLREAVQMVSTREEVEGLCRLDKMIDLIIPRGSFQLVQDIKKAAKGIPVLGHSEGV
CHVYVDADASADKVIGIVRDSKCEYPAACNAMETLLIHRDILRTPLFDQIIDMLRTERVR
IHAGPRFASYLTFSPSEAKSLRTEYNDLECCVEVVDSMQEAVEHIHKYGSSHTDVIITEN
AKTAEQFLQQLDSACVFWNASSRFADGYRFGLGAEVGISTARIHARGPVGIEGLLTTKWV
LRGDGHTVADFSEQGTQTYLHENLPLEQKEILQRDSS
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagaatcatggcagggagatgatgattgtcaccagtggagccgtggcctttgga
aagcaacgattgagacatgagatcctgctgtcccaaagtgttcgacaggcgctgcaatct
ggacacaatcagcccaaagatatgtctctgccggcgctggaggcccgagcctgtgccgca
gccggacagagcggtctaatggccctctacgaggccatgttctctcagtacagcacatgc
acagcacaggttctggtgacaaatctggatttccacgatgacgaaaagcggcagaacctc
cacagcacgctccaggagctactgcgcatgaacatagtgcccatcatcaataccaatgat
gctgtggtgcccccgccagaacccaatagcgacctgcacggggtgataagcattaaggac
aacgatagcctggctgcacgtctggctgtggagatgaaggctgacctgctcatcgcgctc
tctgatgtggaaggcttgtacaacagcccacctggaactgatgatgccaaactcatagac
atcttctaccctggagaccagcactccatcacttttggcacaaagtccagagttgggctt
ggaggcatggaggccaaggtcaaggctgctctctgggccttacagggtggcacctcagtg
gtcatagccaacggtactaacccaaaagtaacaggtcacgtcatcaccgacatcgtggag
ggcaagaaagtgggaaccttcttctctgaaactaaacctgctgggccttcagtagaggag
cagacagaaatggcgcgaagctctgggagaatactggcatctctgcaggcagagaagaga
agtgagatcatctgtcgtctagcagacctgttgactgaaaagacagaggaaatactggca
gctaacaaactggatttggaggttgcaagcagttcaggtcgtttgccttctgccatgcta
aagcgactgagtctgtcagtggccaaaatcaacagtttatccataggccttcgccaaata
gccacgtcagcccagaacagtgcgggtcgtgtgctgcgccggacaagggtggctcataac
ctggagctggagcagatcactgtacctatcggagttgttctggtcatttttgaagcccgg
cctgactgcttaccacaggtgtcagccctggcaatagccagtggcaatgctctactactg
aaaggtggcaaagaggcagctaacaccaaccatgtgttgctccagctcactcaggaagct
ctctctatgcatggactaagagaggctgtgcagatggtgagcactcgtgaggaggtggag
gggctgtgccggctggacaaaatgattgacctgattatccccagagggtcgttccagctg
gtgcaggacatcaagaaggcggccaagggcatcccggtgctcggtcacagcgagggtgtc
tgccacgtctacgttgatgctgatgccagtgccgataaagttataggaatcgtgagagac
tcgaagtgtgaatatccagctgcgtgcaacgcaatggaaactctgctgatccacagagac
atcctcaggaccccactgtttgaccagatcatcgatatgcttcgtactgaacgggtgagg
attcatgcaggcccacgattcgcttcatacctgacgttcagtccatcagaggccaaatct
ctgcggaccgaatacaacgacctggagtgctgcgtggaggtggttgacagcatgcaggag
gctgtagaacatattcacaaatatggcagctcccacacagacgttatcatcacagaaaac
gcaaagacggctgagcagttcttgcagcagctggacagtgcctgcgttttctggaatgcc
agttcacgttttgccgatggctaccggtttggtcttggggcagaggtgggcattagcaca
gctcgcatccacgccaggggtcctgtgggcattgaggggctcctcacaacaaagtgggtt
cttagaggggatggccacacggtcgctgacttctctgaacaaggcacccaaacatacctc
catgaaaacctacctttggaacagaaagagatcttgcagagggacagcagctaa

DBGET integrated database retrieval system