KEGG   Oryzias latipes (Japanese medaka): 101169240Help
Entry
101169240         CDS       T02443                                 

Definition
(RefSeq) delta-1-pyrroline-5-carboxylate synthase-like
  KO
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    101169240
  Amino acid metabolism
   00330 Arginine and proline metabolism
    101169240
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     101169240
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     101169240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 699 aa AA seqDB search
MLQNHGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALQSGHNQPKDMSLPALEARACAA
AGQSGLMALYEAMFSQYSTCTAQVLVTNLDFHDDEKRQNLHSTLQELLRMNIVPIINTND
AVVPPPEPNSDLHGVNVISIKDNDSLAARLAVEMKADLLIALSDVEGLYNSPPGTDDAKL
IDIFYPGDQHSITFGTKSRVGLGGMEAKVKAALWALQGGTSVVIANGTNPKVTGHVITDI
VEGKKVGTFFSETKPAGPSVEEQTEMARSSGRILASLQAEKRSEIICRLADLLTEKTEEI
LAANKLDLEVASSSGRLPSAMLKRLSLSVAKINSLSIGLRQIATSAQNSAGRVLRRTRVA
HNLELEQITVPIGVVLVIFEARPDCLPQVSALAIASGNALLLKGGKEAANTNHVLLQLTQ
EALSMHGLREAVQMVSTREEVEGLCRLDKMIDLIIPRGSFQLVQDIKKAAKGIPVLGHSE
GVCHVYVDADASADKVIGIVRDSKCEYPAACNAMETLLIHRDILRTPLFDQIIDMLRTER
VRIHAGPRFASYLTFSPSEAKSLRTEYNDLECCVEVVDSMQEAVEHIHKYGSSHTDVIIT
ENAKTAEQFLQQLDSACVFWNASSRFADGYRFGLGAEVGISTARIHARGPVGIEGLLTTK
WVLRGDGHTVADFSEQGTQTYLHENLPLEQKEILQRDSS
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagaatcatggcagggagatgatgattgtcaccagtggagccgtggcctttgga
aagcaacgattgagacatgagatcctgctgtcccaaagtgttcgacaggcgctgcaatct
ggacacaatcagcccaaagatatgtctctgccggcgctggaggcccgagcctgtgccgca
gccggacagagcggtctaatggccctctacgaggccatgttctctcagtacagcacatgc
acagcacaggttctggtgacaaatctggatttccacgatgacgaaaagcggcagaacctc
cacagcacgctccaggagctactgcgcatgaacatagtgcccatcatcaataccaatgat
gctgtggtgcccccgccagaacccaatagcgacctgcacggggtaaatgtgataagcatt
aaggacaacgatagcctggctgcacgtctggctgtggagatgaaggctgacctgctcatc
gcgctctctgatgtggaaggcttgtacaacagcccacctggaactgatgatgccaaactc
atagacatcttctaccctggagaccagcactccatcacttttggcacaaagtccagagtt
gggcttggaggcatggaggccaaggtcaaggctgctctctgggccttacagggtggcacc
tcagtggtcatagccaacggtactaacccaaaagtaacaggtcacgtcatcaccgacatc
gtggagggcaagaaagtgggaaccttcttctctgaaactaaacctgctgggccttcagta
gaggagcagacagaaatggcgcgaagctctgggagaatactggcatctctgcaggcagag
aagagaagtgagatcatctgtcgtctagcagacctgttgactgaaaagacagaggaaata
ctggcagctaacaaactggatttggaggttgcaagcagttcaggtcgtttgccttctgcc
atgctaaagcgactgagtctgtcagtggccaaaatcaacagtttatccataggccttcgc
caaatagccacgtcagcccagaacagtgcgggtcgtgtgctgcgccggacaagggtggct
cataacctggagctggagcagatcactgtacctatcggagttgttctggtcatttttgaa
gcccggcctgactgcttaccacaggtgtcagccctggcaatagccagtggcaatgctcta
ctactgaaaggtggcaaagaggcagctaacaccaaccatgtgttgctccagctcactcag
gaagctctctctatgcatggactaagagaggctgtgcagatggtgagcactcgtgaggag
gtggaggggctgtgccggctggacaaaatgattgacctgattatccccagagggtcgttc
cagctggtgcaggacatcaagaaggcggccaagggcatcccggtgctcggtcacagcgag
ggtgtctgccacgtctacgttgatgctgatgccagtgccgataaagttataggaatcgtg
agagactcgaagtgtgaatatccagctgcgtgcaacgcaatggaaactctgctgatccac
agagacatcctcaggaccccactgtttgaccagatcatcgatatgcttcgtactgaacgg
gtgaggattcatgcaggcccacgattcgcttcatacctgacgttcagtccatcagaggcc
aaatctctgcggaccgaatacaacgacctggagtgctgcgtggaggtggttgacagcatg
caggaggctgtagaacatattcacaaatatggcagctcccacacagacgttatcatcaca
gaaaacgcaaagacggctgagcagttcttgcagcagctggacagtgcctgcgttttctgg
aatgccagttcacgttttgccgatggctaccggtttggtcttggggcagaggtgggcatt
agcacagctcgcatccacgccaggggtcctgtgggcattgaggggctcctcacaacaaag
tgggttcttagaggggatggccacacggtcgctgacttctctgaacaaggcacccaaaca
tacctccatgaaaacctacctttggaacagaaagagatcttgcagagggacagcagctaa

DBGET integrated database retrieval system