KEGG   Oryzias latipes (Japanese medaka): 101169558Help
Entry
101169558         CDS       T02443                                 

Gene name
ppox
Definition
(RefSeq) protoporphyrinogen oxidase isoform X2
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00860  Porphyrin and chlorophyll metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101169558 (ppox)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     101169558 (ppox)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     101169558 (ppox)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 Pyr_redox_2 FAD_oxidored MCRA FAD_binding_2 HI0933_like
Motif
Other DBs
NCBI-GeneID: 101169558
NCBI-ProteinID: XP_004077687
UniProt: H2LE92
Position
16
AA seq 474 aa AA seqDB search
MRTVAVLGGGAGGLAASYYLCRSLQVTKVILIESSSRFGGWLKSTRRPDSAVFEQGPRGI
RPAGAVGQNTLNMVDDLGLGREVLPVLYSHVASKNRFLYVNGRLNRMPSGLRGLLRTTPP
FSRPLLYSLASEILVKKSKEEDESVHSFVSRRLGQELADLAVDSLCRGVFAGDCRKLSVR
SCFPPLFKAEQQMGSLILGMLLGSGSTATVTPGPLAKKAKKESWAQWSLRGGLETLPESI
AEYLQRSGKAEIQKNAPVKNISHSELGWKIQLEDGVVSADHIISALPAKALACVLPPSCQ
SLTQMLQDVHAVTVAVVNLEYDGSILPVQGFGHLLPSSEDKGLLGVVYDSVPFPEHNQPD
RETTRLTVMMGGAWFQEVFGDPESVTSEHLLKQACEAVCCQLGVKAAPIWSHVSLQRDCI
PQYYLGHSQRVESMRSFIRSRNLPLSLVGSSFDGVSVNDVIFSGRAAVEELFGV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaggacggtggcggtcctgggaggaggggcgggggggctggctgcatcctactacctg
tgtaggagcctccaggttaccaaggtcattctgatcgagtccagcagccgttttggaggt
tggctgaagtccaccaggagaccagactctgccgtgtttgaacaaggacccagagggatc
cgacctgctggggcagtgggccaaaacaccctcaacatggttgatgacctcggcctgggg
agggaggtcctgcctgtcctgtacagccatgtcgcctccaagaacagattcctgtacgtg
aacgggaggctgaacaggatgccatcaggactgagggggctcctccggaccaccccaccc
ttttctcggccgctcctgtacagcctggcctctgagattctggtgaagaagagcaaagag
gaagacgagtcggtgcactcgtttgtgtcccgtagactgggacaggagttggcagacttg
gcggtggatagtctgtgtcgaggtgtgtttgcgggggactgcagaaagttgagcgtccga
tcgtgcttcccccctctcttcaaggcggagcagcagatgggttctctcatcctgggaatg
ctgctgggctcaggttcaacggctaccgtcactcctggacctttggccaagaaggccaaa
aaagagtcttgggctcagtggtccctcaggggggggctagagaccctaccagaatccatt
gcagagtatctccaaaggagcggcaaggcggagatccagaagaatgcacctgtgaaaaac
attagtcactcggagttgggctggaaaattcaactggaagatggagttgtgtcagccgac
cacatcatctctgcgttgccagcaaaagcactggcgtgtgtcctccccccatcctgtcag
agtctgacccagatgctgcaggacgtccacgctgtcactgttgctgtggtcaacctggag
tatgacggttccatcctgcctgtacagggttttgggcatcttcttccttcatcagaggac
aaaggtttacttggagtggtctatgactctgtccccttccctgaacacaaccagcccgac
agagagaccaccagactgacggtgatgatgggtggcgcctggttccaggaggtgtttggt
gatccagagtctgtgacatcagagcatctcttaaagcaggcctgtgaagcagtgtgctgc
cagctcggagtcaaggcggcacccatttggagccatgtgtctcttcaaagggactgcata
cctcagtattatctgggacactcccagagagtcgaatccatgcggagcttcatcaggagc
aggaatctccctctgtctttggtcggttcctccttcgatggcgtctcggtgaatgatgtc
atctttagtggacgtgcagctgtggaggagctgtttggagtttga

DBGET integrated database retrieval system