KEGG   Oryzias latipes (Japanese medaka): 101169627Help
Entry
101169627         CDS       T02443                                 

Definition
ectonucleoside triphosphate diphosphohydrolase 2-like
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    101169627
Enzymes [BR:ola01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     101169627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 503 aa AA seqDB search
MARRSRLSFASIALLVFALVVILLLTVPTQDVQEAPGFMYGIVLDAGSSHTALFIYRWPA
DKQNGTGVVTQHAECHVQGEGISSYAGQKGEAGESLVACLDQAVRDIPKDKHQLTPVYLG
ATAGMRLLNISNPKQSDQILKEVGDKIKSYPFKFEGAAILSGQEEGAYGWVTVNYLLENF
IKYGFIGRWMSPGRATVGALDLGGASTQITFATQERVEGKQNMMEMRLYGHKYSLYTHSF
LCYGINQVYNRMLAHLVKSQGYVQSVTNPCYPPDVNTTLKMKDVFSSPCTEEHRPKPYNP
EGTLTVKGSGNYQQCEENMSNMFSFEDCPFSQCSFNGISQPNVTGNFMAFSTFFYVHSSL
RKLTGKPVNTPQQLQEAAQTTCSMTLSQMSNQIPDQGPHWMNYCTASVFIKTLVLRGYAF
DNSTFPQISFQKKAGDTSVGWALGYILNLSNLLPAEKVGLRKALTPGVWGTLIFLFALLV
AAALGFLLYRVQSERKDSDEGAI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcgctcccggctctcctttgcgtccatcgcgctgctggtcttcgcacttgtc
gtcatcttgctcctcaccgtccccacccaggacgtccaggaggcgccggggtttatgtac
gggatcgtcttggatgctggatcctcacacacagctttgttcatctatagatggcctgca
gacaagcagaatggcacgggcgtggtcacccagcacgcagaatgccatgtgcagggtgaa
ggcatttccagttatgcaggccaaaaaggggaagcaggggagagcctggtggcctgtctg
gaccaggcagtcagggatattcccaaagacaagcaccagctcacacccgtatatctggga
gccacagcaggcatgaggcttttgaatatttccaacccaaagcagtcggatcagattctg
aaggaagtgggagacaagatcaagtcataccctttcaaatttgaaggcgccgccatactg
agcggtcaggaggagggcgcatacggctgggtcacggtcaactatctcctagagaacttc
atcaagtatggatttattggacggtggatgagccctggcagagccacagtgggagccctt
gacctcgggggggcatctacgcagataacatttgccacacaggagcgagtggaggggaaa
caaaacatgatggagatgcgtctttatggccataagtactccctgtatacacacagcttt
ctctgctatgggattaaccaggtctacaacagaatgctggctcaccttgtaaagtctcag
ggttacgtgcagtcggtgactaacccatgttaccctcccgacgtcaacaccacgctgaaa
atgaaggatgtttttagctctccttgcacagaggagcacagaccaaaaccctacaaccca
gagggtactctgacggtaaaaggcagcggaaactatcagcagtgtgaggaaaacatgtct
aacatgttctccttcgaagattgtccgttctcacagtgttccttcaacggaatctctcag
ccgaatgtcaccgggaacttcatggcgttctctaccttcttttacgttcactcatccctg
cggaaattgacaggaaagccggtgaacacgccgcagcagctgcaggaggcggcgcaaaca
acgtgcagcatgactttgagtcaaatgtcaaatcagattccagatcagggtcctcactgg
atgaactactgcactgcctctgtgttcataaagacactcgtgctgaggggatatgccttc
gataactctacattcccacaaatctcctttcagaaaaaggcgggggacacctcggtgggg
tgggctctgggctacatactgaacttaagtaacctgctgcctgcagagaaagtggggctg
agaaaggccctgaccccaggagtgtgggggacactcatctttctcttcgccctgctcgtc
gctgcagctctgggtttccttctgtatcgagttcagtctgagaggaaggacagcgatgag
ggcgccatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system