KEGG   Oryzias latipes (Japanese medaka): 101169958Help
Entry
101169958         CDS       T02443                                 

Gene name
prlr
Definition
(RefSeq) prolactin receptor
  KO
K05081  
prolactin receptor
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101169958 (prlr)
   04060 Cytokine-cytokine receptor interaction
    101169958 (prlr)
Cytokine receptors [BR:ola04050]
 Class I cytokine receptor (hematopoietin family receptor)
  101169958 (prlr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
12
AA seq 633 aa AA seqDB search
MMKNDGGVRLFWLLLLFLLYTRGKSYSVPGKPTLTRCRSPEKETFTCWWEPGSDGGLPTT
YKLFYRKEGSEKEYQCTDYHTGGKNSCFFNKNDTSIWVNYNITVVATNALGQALSDPLNI
DVYYIVEPNPPENLKVTIQNDKGWPFLRASWDPPTKADTRSGWITLIYELRIKLEEEDEW
EIHHVGQQKVFNIFGLQSEGTYVIQIRCKPDHGFWSEWSEDVQVVVPNYFPNKRSTWVLV
MVFSGMVFLILSWLLHINSRNLKHCILPPVPGPKIKGFDQKLHKSGKSVDAFKSLDVPDF
PHHTFSKSEDLLVEYIEVYVPEEQELMLEKSNNLHNGCLKSENSVSDCDSGRGSCDSHTL
LLDKSGQQTDTQESQTDEQRHGEALQGENLAYTHQDMVSPDMSAGRVKTWPSVFSPLPQN
RSTEDQTSSLEIAKQHCLSDSLLPSDFLTPYHSPPGHCTREHLGSNYWEFDFGNKRPHLT
QPQTEVCHQIQAHSEININTGVKAEPAAQKFPTPRSNEYVEVQRINEEDSVVLRPVASNY
DKLFEMQQGEDYSRVKGVDSDSVLLLLQKEAMEEEMNMCSCEQLTDTTDAHYTTFATSPE
KPTACTHPTPQPLEERVVNGYVDTATMFTMPPY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaatgacgggggagttcgtctcttctggttgctgcttttgtttttgttgtac
acaaggggaaaaagctatagcgtgccaggaaagccaacattaaccagatgtcgttctcct
gaaaaagagaccttcacctgttggtgggagccaggttctgatggaggtctgcccaccacc
tacaaactcttctatcgcaaagaaggctccgaaaaagaatatcaatgcacagactatcac
acaggtgggaagaattcctgcttcttcaataagaacgacacgtccatctgggttaactac
aacatcaccgttgttgccaccaacgctttgggccaggctttgtcagacccactcaacatc
gatgtctattatattgttgagcccaatcctcctgagaacttaaaggtgaccatccagaac
gacaaaggatggccgtttcttcgagcgtcatgggacccgccgacaaaagctgacacccgc
tcgggttggatcacgctcatctatgagctgcgcataaaactggaggaagaggatgaatgg
gagattcaccatgtgggccagcagaaggtgtttaatatttttggcttgcagtcagagggc
acatacgttattcagattcgctgtaagcctgatcatggcttttggagtgaatggagcgag
gatgtccaagtcgttgttcctaactattttcctaacaaaaggtccacctgggtgctagtt
atggtcttttccggcatggtctttctcatcttgagctggctgttacacatcaacagtcgc
aatttgaagcactgcattcttccaccggtccctggtccaaaaattaaaggatttgatcaa
aagcttcacaagagtggaaagtcagtggatgccttcaagtcacttgacgtgcctgatttt
ccccaccacacattctcaaagtccgaggatttgcttgtggagtacatagaagtgtacgtt
cctgaggagcaggagctgatgctggaaaagagcaataatctacacaatggctgcctgaaa
tctgagaactcagtgtctgactgtgattctggccgaggcagctgtgatagtcacaccctg
cttctggataagagtggacaacaaaccgatacccaggagagtcagacggatgagcaaagg
cacggggaagctctgcagggtgaaaatctggcctacactcaccaagacatggttagccct
gatatgtcagctggaagggttaagacgtggccctctgtcttttctccactgcctcagaac
agatcgacagaggatcaaaccagctcacttgagatagccaagcagcactgtctttcagac
agcttgcttccctccgacttcttaaccccctaccattccccacctggacactgcaccaga
gagcatcttggatcaaactactgggagtttgattttggcaacaagcgacctcatttaaca
caaccccaaacagaggtctgtcaccagatccaggctcacagcgaaatcaacatcaacacc
ggtgtaaaagcagaacctgcagctcagaagttccccactccccgatccaatgagtatgtt
gaagtgcagaggatcaatgaggaggatagcgtcgttctccgtccagtcgcatcaaactat
gacaaactctttgaaatgcagcaaggagaggattacagcagggtgaagggggtggacagt
gacagtgtgctcctcctgcttcagaaagaggcaatggaagaagagatgaacatgtgctcc
tgtgagcagttgactgacacaacagacgcccactatacaacatttgccacgagtccagag
aaaccaacggcctgcacacatcctacaccacaacctctggaggaaagggtagttaatgga
tatgttgacactgccactatgttcaccatgcctccttactag

DBGET integrated database retrieval system