KEGG   Oryzias latipes (Japanese medaka): 101169958Help
Entry
101169958         CDS       T02443                                 

Definition
prolactin receptor-like
Orthology
K05081  
prolactin receptor
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    101169958
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101169958
   04060 Cytokine-cytokine receptor interaction
    101169958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 652 aa AA seqDB search
MRVPQGDRPAVEDIQEKDGQNERVARVHEEVLGWGTIQETNLKGYSVPGKPTLTRCRSPE
KETFTCWWEPGSDGGLPTTYKLFYRKEGSEKEYQCTDYHTGGKNSCFFNKNDTSIWVNYN
ITVVATNALGQALSDPLNIDVYYIVEPNPPENLKVTIQNDKGWPFLRASWDPPTKADTRS
GWITLIYELRIKLEEEDEWEIHHVGQQKVFNIFGLQSEGTYVIQIRCKPDHGFWSEWSED
VQVVVPNYFPNKRSTWVLVMVFSGMVFLILSWLLHINSRNLKHCILPPVPGPKIKGFDQK
LHKSGKSVDAFKSLDVPDFPHHTFSKSEDLLVEYIEVYVPEEQELMLEKSNNLHNGCLKS
ENSVSDCDSGRGSCDSHTLLLDKSGQQTDTQESQTDEQRHGEALQGENLAYTHQDMVSPD
MSAGRVKTWPSVFSPLPQNRSTEDQTSSLEIAKQHCLSDSLLPSDFLTPYHSPPGHCTRE
HLGSNYWEFDFGNKRPHLTQPQTEVCHQIQAHSEININTGVKAEPAAQKFPTPRSNEYVE
VQRINEEDSVVLRPVASNYDKLFEMQQGEDYSRVKGVDSDSVLLLLQKEAMEEEMNMCSC
EQLTDTTDAHYTTFATSPEKPTACTHPTPQPLEERVVNGYVDTATMFTMPPY
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcccacagggggacaggccagctgtcgaagacattcaggagaaggatggacag
aatgaacgagttgctagagttcatgaagaagtgttgggatggggaactatccaggagacc
aacctcaaaggctatagcgtgccaggaaagccaacattaaccagatgtcgttctcctgaa
aaagagaccttcacctgttggtgggagccaggttctgatggaggtctgcccaccacctac
aaactcttctatcgcaaagaaggctccgaaaaagaatatcaatgcacagactatcacaca
ggtgggaagaattcctgcttcttcaataagaacgacacgtccatctgggttaactacaac
atcaccgttgttgccaccaacgctttgggccaggctttgtcagacccactcaacatcgat
gtctattatattgttgagcccaatcctcctgagaacttaaaggtgaccatccagaacgac
aaaggatggccgtttcttcgagcgtcatgggacccgccgacaaaagctgacacccgctcg
ggttggatcacgctcatctatgagctgcgcataaaactggaggaagaggatgaatgggag
attcaccatgtgggccagcagaaggtgtttaatatttttggcttgcagtcagagggcaca
tacgttattcagattcgctgtaagcctgatcatggcttttggagtgaatggagcgaggat
gtccaagtcgttgttcctaactattttcctaacaaaaggtccacctgggtgctagttatg
gtcttttccggcatggtctttctcatcttgagctggctgttacacatcaacagtcgcaat
ttgaagcactgcattcttccaccggtccctggtccaaaaattaaaggatttgatcaaaag
cttcacaagagtggaaagtcagtggatgccttcaagtcacttgacgtgcctgattttccc
caccacacattctcaaagtccgaggatttgcttgtggagtacatagaagtgtacgttcct
gaggagcaggagctgatgctggaaaagagcaataatctacacaatggctgcctgaaatct
gagaactcagtgtctgactgtgattctggccgaggcagctgtgatagtcacaccctgctt
ctggataagagtggacaacaaaccgatacccaggagagtcagacggatgagcaaaggcac
ggggaagctctgcagggtgaaaatctggcctacactcaccaagacatggttagccctgat
atgtcagctggaagggttaagacgtggccctctgtcttttctccactgcctcagaacaga
tcgacagaggatcaaaccagctcacttgagatagccaagcagcactgtctttcagacagc
ttgcttccctccgacttcttaaccccctaccattccccacctggacactgcaccagagag
catcttggatcaaactactgggagtttgattttggcaacaagcgacctcatttaacacaa
ccccaaacagaggtctgtcaccagatccaggctcacagcgaaatcaacatcaacaccggt
gtaaaagcagaacctgcagctcagaagttccccactccccgatccaatgagtatgttgaa
gtgcagaggatcaatgaggaggatagcgtcgttctccgtccagtcgcatcaaactatgac
aaactctttgaaatgcagcaaggagaggattacagcagggtgaagggggtggacagtgac
agtgtgctcctcctgcttcagaaagaggcaatggaagaagagatgaacatgtgctcctgt
gagcagttgactgacacaacagacgcccactatacaacatttgccacgagtccagagaaa
ccaacggcctgcacacatcctacaccacaacctctggaggaaagggtagttaatggatat
gttgacactgccactatgttcaccatgcctccttactag

DBGET integrated database retrieval system