KEGG   Oryzias latipes (Japanese medaka): 101170168Help
Entry
101170168         CDS       T02443                                 

Definition
protein-glutamine gamma-glutamyltransferase K-like
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101170168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 779 aa AA seqDB search
MPAVTRSTRNRFATGRFPSVTLGFGEDEVEDKEEEPKEENAGAGKGCQAWWRRVCPCCCP
QVKDDDVTETVTTDPDGGDKDDEKPETGGGELEELLLKVQSIDLMKSRSGQNRTEHHTDL
YQSDNFIIRRGQTFQMWITLSRPFDPRTDTLHLHLKTGPVPLVAKGTHVIVPLVEDMEDN
RWEAVVVEKDDKRMKLSVNSPATAIIGRYQLTVETTSANGQAVSTHDPANDIYMLFNPWS
EDDSVFLDAEKERQEYVLNDVGRIYYGTEEQIGARTWNYGQFDSGILTTCLYILEKSKTL
NSGWGDPVNVVRIVSAMVNSPDDLGVLAGNWSGNYSGGTSPTVWSGSVEILKQYYANKGS
PVNYGQCWVFAGVTTTVMRCLGIPTRTVTNFSSAHDTDVSLTTDVYLDEKLEPLENMNAD
SIWNFHVWNDCWMARPDLPPGNGGWQAVDSTPQETSNGIYRCGPASLTAIRNGQVYLKYD
CPFVFAEVNSDKIYWQRNSDGTYSKIFSEKNVVGRSISTKAVGSDERSDITHMYKHPEGS
EEERIAVETACRYGSKADTYASPTAEDVSIKVAMEGEGPKMGSDAELLIKLNNSSSETRT
VTLHSQLAVMYYTGVNKATVQKDKVEVELPPNEETTLEWSMIYNAYKDQLVDQAALMLTL
SGRVKETQQVLATQFSFRLRTPDLIIKPIGKAVVGKKMAVEISFTNPLPQVLKAVVFNVE
GIGLLPARKILHGDIASQASITLTEHFTPTLAGTRKLVASMDCRQLTQVHGVSNITVEA
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcagtgacaagatcaaccagaaacaggtttgcaacgggcaggtttccgtctgtc
actcttggatttggagaggatgaagtggaagacaaggaagaagaaccgaaagaagaaaat
gcgggagcaggaaaagggtgtcaggcctggtggcgcagggtgtgcccatgctgctgtcca
caagtaaaggatgacgacgtcacagagactgtgaccacagaccccgacgggggggacaag
gacgacgaaaagcccgaaaccggtggtggtgaacttgaagagctccttctaaaggtgcaa
tcaatagacctgatgaaaagcagatcgggacagaaccgcacagaacatcacacggacctc
taccaaagcgacaacttcattatccgcagaggccagaccttccaaatgtggataacattg
tcgagaccttttgatcctcgcaccgacacgcttcacctacacctaaaaacagggccagtg
ccgttggtggcaaagggaacccatgtaattgtccccctggtggaggacatggaggacaac
cgctgggaagccgtcgtggtggaaaaggatgacaaaagaatgaagctgtccgtgaattca
ccagccactgccatcattggcagataccagctcaccgtggaaacgacttctgcaaatggt
caggctgtttccacgcatgaccccgctaatgacatctacatgctcttcaacccctggagt
gaagacgactccgtcttcctggatgctgaaaaggagaggcaggagtacgtcctcaatgat
gtcggacgcatatattatggcactgaagagcaaattggagcgaggacatggaactatgga
cagtttgacagtggcattctgaccacttgcctctacatcctggagaagagcaaaaccttg
aactctggttggggagacccggtgaatgtggttcgaatcgtctctgccatggtaaattca
cctgatgacttgggggtcttggcgggaaactggtcaggcaactattcaggaggaacttct
ccaactgtttggagtggaagtgtagaaatactgaagcaatactatgcaaacaaaggctca
cctgtcaattacggccagtgttgggtgtttgcaggcgtcacaacaacagttatgcggtgt
ttgggcattcccactcgaactgtgaccaatttcagctctgctcatgacaccgacgtttcc
ttgacaacagatgtgtacctggatgagaaactggaacccttggaaaatatgaatgctgat
tctatctggaacttccatgtgtggaacgactgctggatggctcgtcccgacctgcctcca
ggaaatggcggctggcaggctgttgattccacccctcaggagaccagcaatggcatttat
cgctgtggtcctgcttctctcactgctatccgtaacggtcaagtctacctcaaatatgac
tgcccctttgtgtttgcagaggtgaacagtgataagatctactggcaaaggaattcagat
gggacctacagtaaaatcttcagtgagaagaatgtggttggccgcagcatcagcaccaag
gctgtaggctcggatgagcgcagtgatatcacacacatgtacaaacatcctgaaggctct
gaggaggagcgcatcgccgtggaaacagcctgtcgctatggctccaaggcagatacgtat
gcatctcccactgcagaggacgtctctataaaagtggccatggagggagaaggtcccaaa
atggggagcgatgcagaacttctcatcaagttaaacaacagcagctctgagacgcgtact
gtgaccttacatagccagctggcagtcatgtactacactggagtcaacaaagctactgtc
caaaaggacaaggtagaagtggaactgccacccaacgaagagacgaccttggaatggtcc
atgatttacaatgcatacaaagaccagctggtagatcaggcagccctgatgttgacactg
tcaggcagggtcaaagaaacccagcaggtgttggccactcagtttagtttccgcctcaga
accccagacctcatcataaagccgatcgggaaagctgtggttggaaagaagatggcagtg
gagatttcatttacaaacccgctaccacaggtgctgaaagctgtggtattcaatgtggaa
ggcattggtcttctacctgcacgaaaaattcttcatggagatattgccagccaagcctcc
attactctcacggagcacttcacccctacccttgctggaacaaggaaattggtggcttct
atggactgcaggcagctcacacaggttcatggtgttagcaacatcactgtggaggcctga

DBGET integrated database retrieval system