KEGG   Oryzias latipes (Japanese medaka): 101170410Help
Entry
101170410         CDS       T02443                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     101170410
Peptidases [BR:ola01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101170410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 263 aa AA seqDB search
MAFLWILSCLAFIGAAHGCGRPAISPIVTGYSRIVNGEEAVPHSWPWQASLQDWSGFHFC
GGSLINENWVVTAAHCNVRTSHYVILGEHDRNSNAENIQVLNVGQVFKHPQYNSYTINND
ILLIKLATPAQLNTRVSPVCVAETTDNFAGGMMCMTSGWGLTHHANANTPALLQQAALPL
LTNANCSSYWGSNITDLMICAGASGASSCMGDSGGPLVCQKDGAWTLVGIVSWGSSTCST
SMPGVYARVTKLRAWMDQTIAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccttcctgtggatcctctcttgcctcgcctttattggtgccgcccacggttgtggc
aggcctgccatctcccctatcgtgaccggttactctcggattgtgaacggcgaggaggcg
gtgcctcactcctggccctggcaggcgtccctgcaggattggtctggattccacttctgt
ggtggctctctcatcaacgagaactgggtggtgactgctgcccactgcaacgtcaggact
tctcactatgtgatcctcggagaacatgaccgcaactccaacgctgagaacatccaggtg
ctgaacgttggtcaggtgttcaagcaccctcagtacaattcctacaccatcaacaacgac
atcctgctcatcaagctggccacccccgcccagcttaacacccgtgtgtcccccgtgtgt
gtggctgaaaccaccgacaacttcgctggaggcatgatgtgtatgacgtctggctggggt
ctgacccaccatgctaatgcaaacacccccgctctgctgcagcaggctgccctgcccctc
ctgaccaacgctaactgcagcagctactggggcagcaacatcacagacctgatgatctgc
gccggcgcctctggagcctcctcatgcatgggtgactctggcggtcccctggtctgccag
aaggatggagcctggactctggtgggtattgtgtcctggggaagctcaacctgcagcacc
tctatgcccggtgtgtatgcgagagtcactaagctgcgtgcctggatggaccagaccata
gctgctaactga

DBGET integrated database retrieval system