KEGG   Oryzias latipes (Japanese medaka): 101170471Help
Entry
101170471         CDS       T02443                                 

Gene name
kat6b
Definition
(RefSeq) K(lysine) acetyltransferase 6B
  KO
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101170471 (kat6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 2002 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKRQKQRPSEERICHAVATLHGLDKKTILEQLELSVLDGSI
LKVTNKGSTSYKDPGNLGRLGSVLPANTSVPSKDSIWESSDLRHIDWNKILRRAIDGLDD
THGSSLKNIERYLRNQDDLSNVVDNPAFRQRLRLAAKRSVNNGRLLKNGPRYKFSHGGVE
GRSSRCPSASPLLLSLVTLLPHERDQLRVDPIPICSFCLGTKESNRDKRAEELLSCADCG
SSGHPSCLKFSPDLTSNVKKLRWQCIECKTCSSCRIQGKNAEEMLFCDSCDRGFHMECCD
PPLSRMPKGTWICQVCRPKENEKKLLHKKADQIKRRYAKPMGRPRNKLKQRMCVTSVDGS
MVALGGRGSPGRGQKITVCSSPSSGHAASVKDARDRLAVAEPCCVVNASQFTTSTSPPTT
TPTSHTPTSTPATLTINKKTKGLIDGLSKFFTPSPVGRRSRALAVESPSLLYCRDEGPPE
PAKPPEPFAFAADAAQKITPSSSALPPASTLPGPSPPLQVSSSSTSANSPQSSSSQSSVP
SLSSLCSSSQLKGLFDGLSHIYTTQGQSRKKRPPCYAPPKRMPLKQDFSKTGSQCLGKGE
FSKSRLHSTSAGPGRPRGHAFKMLGHFKRNPFLKKHRTLGRLRYKVSPQKGAPSPGKGDS
DGRIKPENIHADHSAVLHAKQRVQAHYVAMSGDHVTEEDAETFARVQELAAQKTGSLTCT
DSSRCPSVIEFGSYEIQTWYSSPYPPEYSKLQKLYLCEFCLKYMRSKNILQRHTKKCGWF
HPPANEIYRKDNLSVFEVDGNVSKLFCQNLCLLAKLFLDHKTLYYDVEPFLFYILTKNDE
KGCHLVGYFSKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLTRQEGQVGSPEKPL
SDLGRLSYLAYWRSVILEHLYMPPDKHISIKGISRATGMCPHDIAATLQQLGMIDRRDGR
TVLVRRERLIQEHMERLRACPRQREVDPKALRWTPSSTLNPVLSEEEREVEMDAERLKER
ASCWEKEEREGYTVTHGHRQPLTKVHCKIPFRTYQRRPTPTWTRRIQQPEAVSDDETDED
SDASPPVLKKAHAILAAKRKRTAILKKRGRKRKQINSSVTTETISETTEVLNEPFDNSDD
EHPMPRLKRSSRGDEMEDDDDEEEETRKLKTVTVPMKRRRGRPRLEKNKLTSNREFWSED
CLLSKRTSKPRPVKRKKGWPKGVKRGPPKWRLKNERKMGFKLNLYTPPETPMEAEQQHEE
AKQDPDQDFGSADEGSKEGRGFSSPVMMQEEVHCPPSSPPQHLSQHLSSPERSLETSPVC
SPAGSVDAVSPAAVERGDSTEPAEEDQQGSGREQDSSAKDLDQSPEGAVSLKTNSVEEVE
LQDADDESHSKAAGPNSCAEDFENLPKETPKCAQPFLNPKDNNGSESSPDVSKVVSAEEP
ASSAEHLQEAVAETTAAKQTPEAVAVATIAAVDSDNPADSESEEECTPSSAPDRPPLPSA
VRSTLSPVLREDPPVCTEIDSETVQAVQSLTQETEAENIFQDCVESQEPCRRLQTYAHVA
QSPQLTSLDDCPHSDHSSPLSSAQSHPSQSVRSVNSPAVSILESGYTQISPDHSAISVPS
LHNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESNAENYENPSSYDSAIGGSICGAGPS
QNSCSYGSIPTSGLPQSSCAVSQQMAAVNPGSCGMIQQNSLSSPPHCSVKSPQGCVVVER
PPSNSQHSQHSTQSRHGPHNQLSQHNQHGPHNQLAPHAQQNPHNQHSHHHNHHLQHNQLS
QHNQHVQHSLHNQHSQHGQQQCAIPTNFTTTMQLADIPESGNPNFSLYERINHQGEYGGG
HYPQSSGLSLAKLQQFTNTFIDHPHSLPFNHSASHPITSYANTPSQHSSIVSLSQTPHRV
PNPQVQATMTPPPNLSSPPHMMLQRNMGIPPSQRIQPQMTSKSHMSARSKSTPLSHHHQQ
QMYARPPQTVAMQAPSRTLAMH
NT seq 6009 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaatcctctgtacacggagtggattcttgaagcaatacagaaaatc
aaaaggcagaagcaaaggccctcggaggaaagaatttgccatgcggtggccacgttgcat
ggactggacaagaagaccatccttgaacagttggaattaagcgttcttgatggctctatc
ctcaaggttacaaataaggggagcacctcctacaaggaccccgggaacctgggaagactc
ggatcggttttgcctgcgaacacatctgtgccatcaaaggattctatatgggaatcgagc
gatctgcgccacatcgattggaataaaatacttaggagggccatcgatggtctggatgat
acccacggctcctctctaaagaacatcgagcgctatctgaggaatcaggacgacctgtca
aacgttgttgataaccctgctttccggcagaggttgcgactggcagcaaagcggtccgtc
aataacggcagattgttgaagaacggtccgaggtataagttcagccatggtggcgtggag
ggaaggagctccaggtgtccaagtgcttcccccttgctcctgtcattggtgacgctcctc
ccacacgaacgagaccagctccgggtcgaccccatcccaatatgcagtttctgtctcgga
acaaaggagtccaatcgagacaagcgagcagaggaactgctgtcctgtgcagactgtgga
agcagtgggcatccatcatgtctgaagttttcccctgacttgacctcaaacgtgaaaaaa
ctacgatggcagtgcatcgaatgcaaaacttgcagctcctgccggatccagggcaaaaac
gcagaggagatgctgttctgcgattcatgtgatcggggctttcacatggagtgctgcgat
ccaccgctttcaagaatgccaaaaggaacctggatctgccaagtctgcaggcccaaggag
aacgagaagaaactactgcacaagaaggccgatcagatcaaacgtcgatatgcaaagcca
atgggaaggcccagaaataagctcaaacaaagaatgtgtgtaaccagtgttgatggctcc
atggtagcacttggaggaagggggtcacctggtaggggtcaaaagattaccgtctgttcc
tcaccttcatctggtcatgctgcatctgtgaaggacgccagagacagattggctgttgca
gagccttgttgtgtggtcaacgcctcccaattcaccacctccacctcccctcccaccacc
acccccacctcccacacgcccacctccactccagccacactcactattaacaagaaaacc
aaagggcttattgacgggctttccaaattcttcactccttccccagtgggccgtcgctcg
cgagctttagccgtagagtcgcccagcctgttgtactgtagggacgagggtccgcccgag
ccggccaagcctccagagccgtttgccttcgctgctgatgccgctcaaaaaataacccct
tcatcctctgcacttcctcccgcttccactttaccaggacctagcccccccttacaggtg
tccagcagctccacctctgctaactcgcctcagagctcttccagccagtctagtgttccc
tccctgagcagtctctgcagtagcagccaactgaagggactttttgatggactttctcac
atttataccactcagggacagtcgcggaaaaagagaccaccttgctacgcgccgcctaag
cgcatgccccttaagcaggatttctccaaaacagggtcccagtgccttggaaaaggcgag
tttagcaaaagtaggttacactctacgtctgccgggcccggccgacccagaggacacgct
tttaagatgctcggtcatttcaaacgtaaccctttccttaaaaagcacaggacgctaggc
aggctcaggtataaagtgagccctcagaagggagccccctcgccaggaaagggagactca
gacggaagaattaagcctgagaatattcatgcggatcacagtgctgtgctgcacgccaag
cagagagtccaagcccactatgtggccatgtccggtgaccacgtcactgaagaggatgcg
gaaaccttcgcacgagtgcaggaactcgcagctcagaaaacgggatcactgacgtgcacg
gattcgagtcgatgcccgtctgtcattgagttcgggagttatgagatccagacgtggtac
tcctcaccgtacccccctgaatattcaaaattacaaaagctttatctgtgcgagttctgc
ctgaagtacatgagaagcaaaaacattctccagaggcacacaaagaagtgcggctggttc
catccaccagccaatgaaatctacagaaaggacaacctttccgtatttgaggttgatgga
aatgtcagcaaactattctgccaaaacctctgcctgttagccaagcttttcctggatcac
aaaaccttgtattatgatgtggagcctttcctcttctacatacttacaaagaacgatgag
aaaggctgtcatcttgtgggctacttctctaaggaaaagctttgccagcagaagtacaat
gtctcctgcataatgatcatgcctcagtaccaaaggcaaggatttggaaggttccttatt
gatttcagttacctcctcaccaggcaagaaggacaagttggctccccggagaagccgctg
tcagatctgggtcgcttatcctacctggcatattggagaagtgtcatactggagcacctt
tatatgcccccagataaacacatcagtattaaaggaataagcagagccactgggatgtgt
ccgcacgacatcgccgccactctccagcagctcggcatgattgacagacgagatggcagg
actgtgttagtcagaagagagcgactgatccaggagcacatggagaggctgagagcctgc
ccacgccagagagaagtggatccaaaggccttacggtggactccttcctccactctcaac
cccgtcctgtctgaggaggagagggaggtggagatggatgctgagcggctgaaggagcgg
gccagttgctgggagaaggaggagagggagggctacaccgtgactcacggacacaggcag
cctctcaccaaggtccactgcaagatccccttccggacctatcagcggcggcccactccc
acctggaccaggcgaatccagcagccggaggcagtaagcgacgacgaaaccgatgaggac
tccgatgcctcgccgcccgtcctgaaaaaagctcacgcgatactggccgccaagagaaag
agaaccgccattctcaagaagagaggccgtaaaaggaagcagataaacagcagcgtgacg
acagaaaccatctctgagaccacggaggtcttgaatgagccgttcgataactccgacgac
gaacaccccatgccccggctaaagcgcagctcaagaggggacgagatggaagatgacgac
gatgaggaggaggagacccgaaagctgaagactgtaactgtgcctatgaagcggcggaga
ggtcgcccaaggctggagaaaaacaagctgacgagcaatcgcgagttctggagtgaagat
tgccttctgtctaagagaacaagcaaacctcgtccagtgaagcggaagaagggctggccc
aaaggagtgaagcgtggccctcctaaatggaggttaaagaatgaacgaaagatgggcttc
aagctgaacctctacactcctcctgagacaccaatggaggcagagcagcagcacgaggag
gcaaaacaggatccagaccaggactttggaagtgcagatgaaggcagcaaagaagggaga
ggtttttctagtccagtcatgatgcaagaggaggtccactgtccaccctcgagtcctcct
caacatctatcccaacatctaagctcccctgaaaggtccctggagacgtctccggtgtgt
tctcctgctggctctgtcgatgcggtttctcctgcagccgtggaaagaggggactccacg
gagccagctgaggaggaccaacagggaagtggacgtgagcaagactcatcagccaaagat
ttggatcagagccctgagggggccgtctccctgaagaccaacagtgttgaggaggtggag
cttcaggatgcagatgatgaaagccacagcaaggcagcaggacccaacagctgcgcggaa
gactttgaaaatcttccaaaggagaccccaaaatgtgcccagccctttttaaatccaaaa
gataacaatggctctgagtcgagtccggatgtatctaaagttgtgagcgcagaggaacca
gcttcttctgcagaacacctgcaggaggcagtggctgaaacgacagctgcaaagcagaca
cctgaggctgtggcagtcgctacgatagcagctgtggactctgataatcctgcagactct
gagtcagaggaggaatgcacgccgagttccgctccagaccggccgcctctgccgtctgca
gtgaggtcgacgctcagccctgtcctgagagaggatcccccagtttgcacagagattgac
tcagagaccgtccaagctgttcagtctctgacacaagaaaccgaggcggagaatattttc
caggactgcgtggagagccaggagccctgcaggcgcctgcagacctatgctcacgtggct
caaagcccccagctcacctcactggacgattgcccccattcggaccacagcagccctctg
tcttctgcacagtcccacccgagccagtcggtgcgctccgttaacagtcctgccgtctcc
atcctagagagcggctacactcagatcagtcccgaccacagcgccatctctgtgccgtcc
ctccacaacatggagaccagtcccatgatggacgtgccgtcagtgtcggatcactcccag
caggtggtggacagcggcttcagtgatctgggcagcattgaaagtaacgcggagaactac
gagaaccccagtagctacgactccgccatcgggggtagcatctgcggggccggcccttcc
cagaacagctgctcgtatggcagcatccccaccagtggcctgccccaaagcagctgcgcc
gtcagccaacaaatggccgccgttaatcccggcagctgtgggatgattcagcagaacagt
ctgagctcgcccccacactgcagcgtcaagtcgccccagggctgcgtggtggtggagagg
ccccccagcaacagccagcacagtcaacacagcacccaaagcaggcatggccctcacaat
caacttagccaacacaatcagcacggtccacacaatcagctagcgccgcacgcccaacaa
aacccccacaaccagcatagccaccaccacaatcatcacctgcagcacaatcagctcagc
cagcacaatcagcatgttcagcatagccttcacaatcaacacagtcagcacggccagcag
cagtgcgccatacccaccaacttcaccaccaccatgcagctggcagatatccccgagtct
gggaaccccaacttcagcctgtatgagaggattaaccaccagggggagtacggcggcggc
cactatcctcagtcgtccggtttgagtctggccaaactgcagcagttcaccaacaccttc
atcgaccatcctcactctctgcctttcaaccactccgcctcacaccccatcacatcttat
gcaaacaccccgtcacagcactccagtattgtgtctttgtcccagaccccgcatcgagtc
cctaacccccaggtgcaggccaccatgacccccccccccaatctgagctcacccccccac
atgatgctgcagcgcaacatgggcatcccgccctcacagcggatccagccccaaatgaca
tcgaagagtcacatgtcggcacgctccaagtccactccgctgtcgcaccaccaccagcag
cagatgtacgcccgaccgccgcagaccgtggccatgcaggccccgtccaggacgctggcc
atgcactga

DBGET integrated database retrieval system