KEGG   Oryzias latipes (Japanese medaka): 101170689Help
Entry
101170689         CDS       T02443                                 

Gene name
tgfbr2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04060  Cytokine-cytokine receptor interaction
ola04068  FoxO signaling pathway
ola04144  Endocytosis
ola04218  Cellular senescence
ola04350  TGF-beta signaling pathway
ola04520  Adherens junction
ola04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101170689 (tgfbr2)
   04350 TGF-beta signaling pathway
    101170689 (tgfbr2)
   04068 FoxO signaling pathway
    101170689 (tgfbr2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101170689 (tgfbr2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101170689 (tgfbr2)
  Cell growth and death
   04218 Cellular senescence
    101170689 (tgfbr2)
  Cellular community - eukaryotes
   04520 Adherens junction
    101170689 (tgfbr2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101170689 (tgfbr2)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101170689 (tgfbr2)
Protein kinases [BR:ola01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101170689 (tgfbr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase P12
Motif
Other DBs
NCBI-GeneID: 101170689
NCBI-ProteinID: XP_023815561
Position
11
AA seq 540 aa AA seqDB search
MGTLQLSVFWWGAVLVGSFLLPEAESYFLIKLRALCKFCDVEATSCMGEGMCKVECNKTA
ICEHEEDVCVTIWRKKDDNVTLETLCHDPAKKLYGLTLHDYKGKRCEMKAVSGMNSDFFI
CSCSEEECNMDVFFTTNFSPDHHVVAVVLVSLMPLLVMAVLVVASFYCYRVFRKHQAHHG
CKKCSPLDCSDARPIVLDNEGSDSSSTLANNLNHNMELLPIELDVLVGKGRFAEVYKAKL
KQGSSVREEQGFETVAIKIFPCDEYASWKNEKDIFSDADLRHENVLHFLTAEERKVQRQY
WLITAYHPLGNLQEYLVRHVISWHDLLIMGSSLSWGVAHLHSDQTTCGRPKVPIAHRDIK
SSNILLKKDLTCCICDFGLALRLDNSLSVDELANSGQVGTARYMAPEVLESRINLENIES
FKQADVYSMALVLWELISRCSSIGEVKEYEPPFGNMGEHPCVESMKDSVLRDKGRPEIPS
SWTSHTGIQTVCASIEECWDHDPEARLTAHCVAERFNDIEYLDKLSECSDTEVKIPEDEK
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggggacccttcagctttccgttttttggtggggggcggttctggtcggcagttttctg
ctcccggaggcggagagctattttttaattaaactaagggctctgtgcaagttttgtgac
gtggaggccaccagctgcatgggagagggaatgtgcaaggtggaatgtaacaaaacggcc
atctgtgaacatgaagaggacgtgtgtgtcaccatttggaggaagaaagatgacaacgtt
actttggagacgttgtgccatgaccctgctaagaaactctacggcctgactctgcacgat
tacaaaggcaaacgatgcgagatgaaagcagtttccggcatgaactccgacttcttcatc
tgttcctgctcggaggaagagtgcaacatggacgtctttttcaccacaaacttctccccg
gaccaccacgtggtggctgtggtcctggttagcctgatgcctcttctggtcatggccgtc
ctcgtcgtcgcctccttctactgttaccgcgtcttccgcaagcaccaagcacaccacggg
tgcaagaagtgttctcccctggactgcagcgatgcccgtcccatcgtgttagacaacgag
ggttcggacagcagctccacgctcgccaacaacctcaaccacaacatggagctgctgccc
atcgagctggacgtcctcgtcgggaagggccgctttgctgaggtttacaaagccaagctg
aagcaaggctcgtccgtgcgggaagagcaaggctttgagacggtcgccatcaagatcttc
ccgtgcgacgagtacgcctcttggaagaacgagaaggacatcttctcggacgcagatctg
aggcatgaaaacgtgcttcacttcctgacagcggaggaaaggaaagtgcagagacagtac
tggctcatcacagcttaccatccgcttggaaacctccaggagtacctggtccgtcacgtc
atcagctggcacgaccttctgataatggggagctcgctgtcgtggggagtggcacacctc
cacagcgaccagacgacctgcggccgccccaaggtgcccatcgcccatagagacattaag
agctccaacatccttttgaaaaaggacttgacctgctgcatctgcgacttcggcctcgct
cttcggctggacaactccctgtccgtggacgagttggccaacagtgggcaggtgggaacg
gccaggtacatggcccccgaggtgttggagtccaggatcaacctggaaaacatcgagtcc
ttcaaacaagcggatgtttattccatggctctggttctgtgggagctcatctccagatgc
agctcgatcggagaggtgaaagagtacgagccgccgttcgggaacatgggggagcatccg
tgtgtggagagcatgaaggacagtgttctgagggacaaaggaagacctgagatccccagc
agctggaccagccacaccggcatccagacggtgtgcgcctccatagaggagtgctgggac
cacgacccggaggcccggctcacggcgcactgcgtcgccgagcgcttcaacgacatcgag
tacctggacaagctgtccgagtgctccgacacggaggtgaagatccccgaggacgagaag
tga

DBGET integrated database retrieval system