KEGG   Oryzias latipes (Japanese medaka): 101170699Help
Entry
101170699         CDS       T02443                                 

Gene name
abhd12
Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101170699 (abhd12)
Peptidases [BR:ola01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101170699 (abhd12)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101170699 (abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
15
AA seq 375 aa AA seqDB search
MRKRRSPLCAEQDSDEALKRRSADSSRQDPQEEGSMKKPFRRLGLVGKIKRIFLVLMIIY
VSIPCIVKIFPSIQAKLVFLNFVRVPFFIDLKRPQDHGLNHTHNFYLEPESGLKAGVWHT
VPAQMWREAQGKDGNWYLSTFSSSNPVILYLHGNAGTRGGDHRVQLYKVLSSLGYHVVTF
DYRGWGDSEGSPSEGGMTSDALFVYDWLKQQIGKTKPLYIWGHSLGTGVATNLVRRLCDR
GNPPDALILESPFTNIREEAKCHPFSMVYRYLPGFDWFFLDAITANNIRFASDENVNHIS
CPMLILHAEDDTVVPFYLGKKLYSMASRSQSLTGHKVQFVPFPASLGYKHKFIYRSPELP
SILSDFLGVAHPLAP
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcggaagcgcaggagcccgctgtgcgcggagcaggacagcgacgaggcgctgaagcgg
cgttctgcggacagcagccggcaggacccgcaggaggagggtagcatgaagaaaccgttt
aggaggctcgggctggtgggtaaaataaagaggatcttcttggtgctgatgatcatctat
gtgtcgataccttgcattgtcaagatctttccttccattcaggccaaacttgtcttcctt
aactttgtcagggtgccgttcttcatagacctgaagcgtccgcaggaccatggcttaaac
cacacccacaacttctacctggagcctgagagcggcctcaaagccggagtctggcacacg
gttcccgctcaaatgtggagagaagctcagggtaaagacggcaactggtacctctccacg
ttcagctcctccaaccccgtcattctctatctccatggtaacgcagggaccagaggagga
gaccacagagtgcagctatacaaggtcctcagctcgttaggctaccacgtggtcacgttt
gactacagaggttggggggattcggaaggttcgccgtcagaaggcgggatgacatcagac
gcactctttgtctatgattggctgaagcagcaaattggaaaaacgaagccgctttacatc
tggggccactctctgggaacaggagtcgccacaaacttggtgagacggctgtgtgacaga
ggaaatccaccagatgctctaatcttagagtctcccttcacaaacatcagagaggaggcc
aagtgccacccgttctccatggtgtacaggtatctcccgggctttgattggttcttcctg
gatgccatcactgccaacaacatccgctttgccagcgatgagaacgtaaaccacatttcc
tgtccaatgctgatactccacgcggaggacgacactgtggttcctttctatcttggaaaa
aagctctacagcatggcgtcgcgctcgcaaagcctcaccggtcacaaggtccagtttgtg
ccattcccggcatcattggggtacaaacacaagtttatctacaggagcccggagctgcca
agcatcctcagtgacttcctgggcgtggctcacccactcgcaccatga

DBGET integrated database retrieval system