KEGG   Oryzias latipes (Japanese medaka): 101170930Help
Entry
101170930         CDS       T02443                                 

Gene name
kat2a
Definition
(RefSeq) lysine acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101170930 (kat2a)
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101170930 (kat2a)
Transcription machinery [BR:ola03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101170930 (kat2a)
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101170930 (kat2a)
   HAT complexes
    PCAF complex
     101170930 (kat2a)
    STAGA complex
     101170930 (kat2a)
    TFTC complex
     101170930 (kat2a)
    SAGA complex
     101170930 (kat2a)
    SLIK complex
     101170930 (kat2a)
    ADA-HAT complex
     101170930 (kat2a)
    HAT-A2 complex
     101170930 (kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
8
AA seq 760 aa AA seqDB search
MSDPAAQASQPRLPQTQSAGSAGSGNAATGSGSGNSDPARPGLSQQQRASQKKAQVRAFP
RAKKLEKLGVFSACKANDTCKCNGWKNPNPPSATRLDLQQQAASLSEPCRSCGHALAEHV
SHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSQPVVE
GSLGTPPFERPNIEQGVLNFVQYKFSHLAPKERQTMFELSKMFLLCLNYWKLETPTQYRQ
RTQKEDGAPYKVDYTRWLCYCHVPQSNDSLPRYETTQVFGRNLLKSIFTVTRRQLLEKFR
VEKDKLLPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASDGTQLGHQTVISPA
AVSGSPALSKSLSGGSSTVDSGGVEPIPGEKRKLPEALTLEDAKRIRVMGDIPMELVNEV
MMTITDPAAMLGPETNLLTPNAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVG
LQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVT
SNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQVCFFDLFIKRQKEIIKK
LIERKQSQIRKVYPGLTCFKEGVRQIPVESIPGIRETGWKPSSKDKSKEVKDPDVLYNTL
KNLLAQIKTHPDAWPFMEPVKKSEAPDYYEIIRFPIDLKTMTDRLKNRYYVTKKLFIADL
QRIISNCREYNPPDSEYCKCANTLEKFFYFKLKDGGLIDK
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacccggcagcgcaggcctcacaaccccggcttccacagacccagtccgctggg
tcagctgggtccggtaatgctgcaacaggctccgggtcgggcaatagcgacccggctagg
ccaggactcagccagcaacagcgcgctagccagaagaaagcccaagttcgagctttccca
cgggcgaaaaagctggagaaacttggcgtgttctccgcatgcaaggccaatgacacatgc
aaatgcaacggatggaagaacccaaacccaccgtcagccacccgtctggatctgcagcag
caagcagccagcctgagcgagccctgccgcagctgtggacatgctctggcggagcacgtg
tctcatctggagaatgtgtctgaggaggagatcaacaggctgctgggcatggtggttgac
gtggagaacctgttcatgtctgtgcacaaagaggaggacactgataccaaacaagtgtac
ttttacctcttcaagctgctgaggaaatgcatccttcagatgagccagcctgttgtggag
ggatctctgggaacccctccttttgaaaggcccaacattgagcagggagttctgaatttt
gttcagtacaagtttagccacctagccccaaaggaaaggcagaccatgtttgagctgtcg
aagatgttccttttgtgtctgaactactggaagctcgagacgccgacgcaataccgccag
cgcacccaaaaggaagacggggcgccatataaagtggactacaccaggtggttgtgctac
tgccacgtcccgcagagcaacgacagcctgccgcgctacgaaaccacgcaggtgtttggg
cgaaacttactcaagtccatcttcacggtgacccggcgccagctcctggagaagttccga
gtggagaaagataaactgctgccagagaaacgcacacttatcctcacacatttccccaag
ttcctgtcaatgctggaggaggaaatctatggagagaactcccccatttgggaggccgac
ttcacgatgccggcctcagacggcacacagttgggccatcagacagtgatcagtccggct
gcagtgtccggttctcctgctctgtccaagtctctgagcggcggctcatccaccgtggac
tctggaggggtggagcccatcccaggcgagaagcggaaactaccggaggcgctaacactg
gaggatgccaagcggatccgtgtgatgggagacattcctatggagctggtcaacgaagtc
atgatgacaatcacagatcctgccgccatgctgggtccagagacgaatctcctcacaccg
aatgccgcccgagacgagactgccaggctggaagagaggcgcggcattattgagttccac
gtcatcggaaactccctttcccagaagtccaacaagaagatcttgatgtggctggtgggc
cttcagaacgtcttctctcatcagttgccccgcatgccaaaggaatacatcacacggctg
gtgtttgacccgaagcacaaaaccctcgccctgatcaaagatggccgtgtaattggaggc
atctgttttaggatgtttcccactcagggcttcacagagattgtcttctgtgccgtcaca
tccaacgagcaagtaaagggctacggcacgcacctgatgaatcacctgaaggagtaccac
atcaaacacaacatcctttacttcctgacttacgctgacgagtacgccatcggctacttc
aagaagcaggtttgctttttcgacctctttattaagagacagaaggagattattaaaaag
ttaattgagaggaaacagagtcagatcaggaaggtttacccaggtctcacgtgcttcaaa
gagggcgtgcggcagatcccagtggagagcattccaggcatccgggagacaggctggaag
cccagcagcaaagacaaaagtaaagaggtgaaagaccccgatgttctatataacacactg
aaaaacctcctggcccagataaagacccatccagacgcctggccctttatggaaccagtg
aagaagtccgaagctccggattactacgagatcatccgctttcctattgatctgaaaacc
atgaccgacaggttaaaaaacagatactatgtgaccaagaagcttttcatcgctgacctg
cagcgaatcatcagcaactgtcgcgagtacaaccctccagacagcgagtactgcaagtgt
gccaacaccctggagaagttcttctacttcaaattaaaagatggaggcctcattgacaaa
tga

DBGET integrated database retrieval system