KEGG   Oryzias latipes (Japanese medaka): 101170930Help
Entry
101170930         CDS       T02443                                 

Gene name
kat2a
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101170930 (kat2a)
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101170930 (kat2a)
Transcription machinery [BR:ola03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101170930 (kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 760 aa AA seqDB search
MSDPAAQASQPRLPQTQSAGSAGSGNAATGSGSGNSDPARPGLSQQQRASQKKAQVRAFP
RAKKLEKLGVFSACKANDTCKCNGWKNPNPPSATRLDLQQQAASLSEPCRSCGHALAEHV
SHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSQPVVE
GSLGTPPFERPNIEQGVLNFVQYKFSHLAPKERQTMFELSKMFLLCLNYWKLETPTQYRQ
RTQKEDGAPYKVDYTRWLCYCHVPQSNDSLPRYETTQVFGRNLLKSIFTVTRRQLLEKFR
VEKDKLLPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASDGTQLGHQTVISPA
AVSGSPALSKSLSGGSSTVDSGGVEPIPGEKRKLPEALTLEDAKRIRVMGDIPMELVNEV
MMTITDPAAMLGPETNLLTPNAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVG
LQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVT
SNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQVCFFDLFIKRQKEIIKK
LIERKQSQIRKVYPGLTCFKEGVRQIPVESIPGIRETGWKPSSKDKSKEVKDPDVLYNTL
KNLLAQIKTHPDAWPFMEPVKKSEAPDYYEIIRFPIDLKTMTDRLKNRYYVTKKLFIADL
QRIISNCREYNPPDSEYCKCANTLEKFFYFKLKDGGLIDK
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacccggcagcgcaggcctcacaaccccggcttccacagacccagtccgctggg
tcagctgggtccggtaatgctgcaacaggctccgggtcgggcaatagcgacccggctagg
ccaggactcagccagcaacagcgcgctagccagaagaaagcccaagttcgagctttccca
cgggcgaaaaagctggagaaacttggcgtgttctccgcatgcaaggccaatgacacatgc
aaatgcaacggatggaagaacccaaacccaccgtcagccacccgtctggatctgcagcag
caagcagccagcctgagcgagccctgccgcagctgtggacatgctctggcggagcacgtg
tctcatctggagaatgtgtctgaggaggagatcaacaggctgctgggcatggtggttgac
gtggagaacctgttcatgtctgtgcacaaagaggaggacactgataccaaacaagtgtac
ttttacctcttcaagctgctgaggaaatgcatccttcagatgagccagcctgttgtggag
ggatctctgggaacccctccttttgaaaggcccaacattgagcagggagttctgaatttt
gttcagtacaagtttagccacctagccccaaaggaaaggcagaccatgtttgagctgtcg
aagatgttccttttgtgtctgaactactggaagctcgagacgccgacgcaataccgccag
cgcacccaaaaggaagacggggcgccatataaagtggactacaccaggtggttgtgctac
tgccacgtcccgcagagcaacgacagcctgccgcgctacgaaaccacgcaggtgtttggg
cgaaacttactcaagtccatcttcacggtgacccggcgccagctcctggagaagttccga
gtggagaaagataaactgctgccagagaaacgcacacttatcctcacacatttccccaag
ttcctgtcaatgctggaggaggaaatctatggagagaactcccccatttgggaggccgac
ttcacgatgccggcctcagacggcacacagttgggccatcagacagtgatcagtccggct
gcagtgtccggttctcctgctctgtccaagtctctgagcggcggctcatccaccgtggac
tctggaggggtggagcccatcccaggcgagaagcggaaactaccggaggcgctaacactg
gaggatgccaagcggatccgtgtgatgggagacattcctatggagctggtcaacgaagtc
atgatgacaatcacagatcctgccgccatgctgggtccagagacgaatctcctcacaccg
aatgccgcccgagacgagactgccaggctggaagagaggcgcggcattattgagttccac
gtcatcggaaactccctttcccagaagtccaacaagaagatcttgatgtggctggtgggc
cttcagaacgtcttctctcatcagttgccccgcatgccaaaggaatacatcacacggctg
gtgtttgacccgaagcacaaaaccctcgccctgatcaaagatggccgtgtaattggaggc
atctgttttaggatgtttcccactcagggcttcacagagattgtcttctgtgccgtcaca
tccaacgagcaagtaaagggctacggcacgcacctgatgaatcacctgaaggagtaccac
atcaaacacaacatcctttacttcctgacttacgctgacgagtacgccatcggctacttc
aagaagcaggtttgctttttcgacctctttattaagagacagaaggagattattaaaaag
ttaattgagaggaaacagagtcagatcaggaaggtttacccaggtctcacgtgcttcaaa
gagggcgtgcggcagatcccagtggagagcattccaggcatccgggagacaggctggaag
cccagcagcaaagacaaaagtaaagaggtgaaagaccccgatgttctatataacacactg
aaaaacctcctggcccagataaagacccatccagacgcctggccctttatggaaccagtg
aagaagtccgaagctccggattactacgagatcatccgctttcctattgatctgaaaacc
atgaccgacaggttaaaaaacagatactatgtgaccaagaagcttttcatcgctgacctg
cagcgaatcatcagcaactgtcgcgagtacaaccctccagacagcgagtactgcaagtgt
gccaacaccctggagaagttcttctacttcaaattaaaagatggaggcctcattgacaaa
tga

DBGET integrated database retrieval system