KEGG   Oryzias latipes (Japanese medaka): 101171032Help
Entry
101171032         CDS       T02443                                 

Definition
NAD-dependent protein deacetylase sirtuin-6-like
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101171032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 347 aa AA seqDB search
MSVNYAAGLSPYADKGVCGLPEKFDSPEELKEKVQTLAELVKESQYLVVHTGAGISTSAG
IPDFRGPKGVWTLEEKGESPHFDTTFEDARPSLTHMALLGLERAGYLKYLISQNVDGLHV
RSGFPRDKLSELHGNMFVEECEKCGRQYVRDKVIGVMGLKPTGRFCSVVRSRGLRGCRGK
LISTILDWEDALPDRDLNRADDASRKADLALTLGTSMQIKPSGDLPLLTKRKGGRIAIVN
LQPTKHDKQAHLRIHGYVDEVMKQLMEQLGLDIPKWEGPVVHESSEVLPDIKPPHCISAD
GKVKKEEIKIERKREATQLTGEEDVKEEAGSVKKERADLTLLINEEK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaattatgctgccggattgtcaccttacgcagataagggggtctgcggcctt
cctgagaagtttgacagtcctgaagagctgaaggagaaggtgcagactcttgctgagttg
gttaaagaatctcagtacctggtcgtccacactggagctggcatcagcacctcagccggc
atccctgacttcaggggtcccaaaggagtgtggactctagaggaaaagggtgagtcgcct
cactttgatacgacgtttgaagacgctcggcccagcttgactcacatggccctcctggga
ctggagagggccggctacctcaagtatctgatcagccagaacgttgacggcctgcatgtt
cgttcaggctttcccagggacaagttatcagagcttcacggaaacatgtttgtggaggag
tgtgagaagtgtggcagacaatatgtcagagacaaggtgattggcgtgatgggactcaaa
ccaacaggccgtttctgcagtgtggtgcgatccagaggactgaggggctgcagagggaag
ctgatcagcacaatattggattgggaggacgcacttcctgacagggatctgaaccgagcg
gatgatgcaagcaggaaagcagacctggcactgactctgggcacgtccatgcagatcaaa
cccagcggagacctcccactcctcacaaagcgcaaaggagggaggatagctatagtcaac
ctgcagcccacaaagcatgacaaacaggcccacctccgtatccatggttacgtggacgag
gtcatgaaacagctgatggagcagttaggcttagacatcccaaagtgggagggacctgtt
gtgcatgagagctctgaagtcctgcccgacatcaaaccaccgcactgcatttctgctgac
gggaaggtgaaaaaggaagaaattaaaatagagagaaaaagagaagcaacacaactaaca
ggcgaggaggatgtgaaggaggaggcaggttcagtaaaaaaggagagagcagatttgaca
ttgttaataaatgaagaaaaataa

DBGET integrated database retrieval system