KEGG   Oryzias latipes (Japanese medaka): 101171114Help
Entry
101171114         CDS       T02443                                 

Definition
arginase-1-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    101171114
  Amino acid metabolism
   00330 Arginine and proline metabolism
    101171114
Enzymes [BR:ola01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     101171114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 340 aa AA seqDB search
MNRWRALRQLGCIPARSLPPPRHLHSAGIIGAPFSKGQVKGGVEAGPDHIRAAGLVERLQ
LQGCAVKDYGNLVFEHVSGDEPVGKLKSVRAVGSANQRLSVAMREVKEGGHTAVMLGGDH
SLAIGSIHGHAAALGQLGVLWVDAHADINTPLTSYTGNIHGQPLSYLLHELQSKVPALPN
FSWMKPCLSAGDLVYIGLRDVDPAEHYILQMLGVKMFSMSKVDQLGVAKVMEEACDYLST
RGKKPIHLSFDIDAIDPSITPATGTPVTGGLTYREGLCIAEHLSQTGLLSAVDLVEVNPL
RGQTQDDVQSTVSTAVDLLLACFGRQREGNHLQDYCLPEP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggtggagggcgctgcggcagctcggatgcatccccgcgcggagccttcctcct
cctcgtcatcttcactccgccggaatcatcggtgcaccgttttccaaaggacaggtgaaa
ggtggagtggaagctggaccggaccacatccgagccgcgggcctggttgaacggctgcag
ctgcaagggtgtgcagtgaaggattatgggaacctggtatttgagcacgtgtccggggac
gagcccgtggggaagctgaagagcgtgcgggcggtgggcagcgccaaccagaggttgtct
gtggcgatgcgggaggtgaaagagggcgggcacacggccgtcatgctgggaggagaccac
agtctggctatcggctcgattcatggtcatgctgctgctctgggacagctgggcgtcctg
tgggttgatgcccatgccgacatcaacacgcctctgacgtcctacacggggaacatccac
gggcagcccttgtcttacctcctccatgagctgcagtcaaaggttcccgctctgccaaac
ttctcctggatgaagccgtgcctgtcagctggagatctcgtctacatcggcctgagagac
gtggatccagcagagcactacatccttcagatgctgggcgtgaagatgttctccatgtca
aaagtggatcagttgggcgtggccaaagtaatggaggaggcgtgtgactacctgagtacc
agggggaagaagccaatccacctgagctttgacattgacgccattgacccctccattact
ccagcaacaggaacacctgtgaccggaggactcacctaccgagaaggactctgcatcgct
gaacacctgagtcagacaggcttgctgtcggcggtggacctggtggaagtgaatcccctg
agaggacagacgcaggacgacgtccagtccacggtcagcacagctgtggacctgctgctc
gcatgttttggccgtcagcgtgaaggaaatcacctgcaagattactgcctgcctgagccg
taa

DBGET integrated database retrieval system