KEGG   Oryzias latipes (Japanese medaka): 101171346Help
Entry
101171346         CDS       T02443                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101171346
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     101171346
Glycosyltransferases [BR:ola01003]
 Glycan extension
  Type 3 chain
   101171346
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 284 aa AA seqDB search
MLPAGANVHSAGNVPQTGRILCWIMTAPKNLETRTRHVRETWAKHCFKALYMSSAKTEFP
TVGLNVSEGRGNLYWKTILALQHIHQHHLDEADWFLKADDDTYVIMENLNYVLSKHDPER
PLYFGRRFAPFVSQGYMSGGAGYVLSKGALRRFIEGFTTGKCTHFSPIEDMALGKCMETM
KVEPGDSRDVMGRQTFHPFPPEYYLVPQLPRPRPWFLNYEYYKPVEGPGCCSDFAVSFHY
ISAAQMYVLEYLTYHLRPHGYKHRFNPDDDKASGPVALPPAALG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgctgccagcaggggcaaacgtccactctgctgggaatgtcccccaaacggggcggatc
ttgtgttggatcatgacagcacctaagaacttggagacccgaacaagacacgtcagggaa
acttgggccaagcactgcttcaaagcgctttacatgagctcagcgaagaccgagttcccg
actgtggggctaaacgtgagtgagggcagaggcaatctctactggaagaccattctggcc
cttcagcacatccaccagcatcacctggatgaagcggactggttcctgaaggcagacgat
gacacctatgtgatcatggagaatctaaactatgttttgtccaaacatgatccagagaga
cctctgtactttggcaggcggtttgcacctttcgtcagccagggctacatgagtggaggg
gcaggctacgttctcagcaagggggcgctgaggaggttcatagaaggctttaccacagga
aaatgcacccacttctcccccatagaagacatggctttggggaaatgcatggagacaatg
aaagtggaaccgggagactccagagatgtgatgggaagacaaacctttcatccttttccc
ccggaatattaccttgttccacagctaccaagacctcgaccttggtttctgaattatgaa
tattacaagccagtggagggtcctgggtgctgctcagactttgcggtgtctttccactac
atttctgctgcgcagatgtacgtgctagagtacctcacgtaccacctgcggcctcacgga
tacaaacataggtttaaccctgatgatgacaaagccagtggcccggtggcgctgcctcca
gcagctctcggatga

DBGET integrated database retrieval system