KEGG   Oryzias latipes (Japanese medaka): 101171358Help
Entry
101171358         CDS       T02443                                 

Definition
glutathione S-transferase kappa 1-like
Orthology
K13299  
glutathione S-transferase kappa 1 [EC:2.5.1.18]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Peroxisome
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101171358
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101171358
   00982 Drug metabolism - cytochrome P450
    101171358
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101171358
Enzymes [BR:ola01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101171358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 228 aa AA seqDB search
MASRKVVELFYDVVSPYSWLGFEVMCRYRHVWNIELKLRPAFLGGVMHGSGNKPPGMVPN
KFKYMDKDLTRLAKYFDVPLKCPADPFEVMFQKGSMSAMRFVTAVQERETGGDEQVEQVS
RELWRRIWSEDKDITQPESMSEAAKKAGLSDSDVEAALQLYTSQPIKDKLKNTTEHALSY
GAFGFPMIVCHIDGKPEIFFGSDRFELMAFCIGEKWLGPKPDKSAARL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgagaaaggtggtggagttgttctatgatgtggtgtctccgtactcctggctg
ggatttgaggttatgtgtcgctacagacatgtgtggaacatcgagctgaaactgcgtccg
gcttttctgggaggcgtcatgcacggatcaggcaacaagcctcctggtatggttcctaac
aaatttaaatatatggacaaggacctcacccgcttggcaaaatactttgatgtcccttta
aagtgtccagcagacccgtttgaggtcatgttccaaaaaggctccatgtctgcaatgcga
tttgtcacagcagtgcaagagagggagacaggtggagacgagcaggtggagcaggtttcc
cgtgagctgtggagacggatctggagtgaagataaagacattacccagcctgaatcgatg
tctgaggcagcaaagaaagctggactgtctgacagtgatgtcgaagcagcactacagctg
tatacttcccagccgattaaagacaagcttaaaaacacaacagagcatgcacttagttat
ggggcgtttggcttccccatgattgtgtgtcatattgatggaaagccagaaatatttttt
ggatctgacagatttgagctcatggccttctgcattggtgagaaatggctgggccctaaa
cctgataaatcagctgccagactgtga

DBGET integrated database retrieval system