KEGG   Oryzias latipes (Japanese medaka): 101171358Help
Entry
101171358         CDS       T02443                                 

Definition
glutathione S-transferase kappa 1-like
Orthology
K13299  
glutathione S-transferase kappa 1 [EC:2.5.1.18]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Peroxisome
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ola00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:ola00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:ola00982]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:ola04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 228 aa AA seqDB search
MASRKVVELFYDVVSPYSWLGFEVMCRYRHVWNIELKLRPAFLGGVMHGSGNKPPGMVPN
KFKYMDKDLTRLAKYFDVPLKCPADPFEVMFQKGSMSAMRFVTAVQERETGGDEQVEQVS
RELWRRIWSEDKDITQPESMSEAAKKAGLSDSDVEAALQLYTSQPIKDKLKNTTEHALSY
GAFGFPMIVCHIDGKPEIFFGSDRFELMAFCIGEKWLGPKPDKSAARL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgagaaaggtggtggagttgttctatgatgtggtgtctccgtactcctggctg
ggatttgaggttatgtgtcgctacagacatgtgtggaacatcgagctgaaactgcgtccg
gcttttctgggaggcgtcatgcacggatcaggcaacaagcctcctggtatggttcctaac
aaatttaaatatatggacaaggacctcacccgcttggcaaaatactttgatgtcccttta
aagtgtccagcagacccgtttgaggtcatgttccaaaaaggctccatgtctgcaatgcga
tttgtcacagcagtgcaagagagggagacaggtggagacgagcaggtggagcaggtttcc
cgtgagctgtggagacggatctggagtgaagataaagacattacccagcctgaatcgatg
tctgaggcagcaaagaaagctggactgtctgacagtgatgtcgaagcagcactacagctg
tatacttcccagccgattaaagacaagcttaaaaacacaacagagcatgcacttagttat
ggggcgtttggcttccccatgattgtgtgtcatattgatggaaagccagaaatatttttt
ggatctgacagatttgagctcatggccttctgcattggtgagaaatggctgggccctaaa
cctgataaatcagctgccagactgtga

DBGET integrated database retrieval system