KEGG   Oryzias latipes (Japanese medaka): 101171545Help
Entry
101171545         CDS       T02443                                 

Definition
protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ola04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
24
AA seq 442 aa AA seqDB search
MKPLLLGVLGCSLLLSVEALYSPSDDVVELTPSNFNREVMQSDSLWLVEFYAPWCGHCRN
LAPDWKKAATALKGIVKVGAVDADEHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGARSS
QAIVDGAMNALRSLVKDRLSGKSGSSGYSRQSDSGSSGSSKDVVELTDDNFDKTVLQSDD
VWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVDATVHQVLSSRYGVRGFPT
IKIFRKGEEPEDYQGGRTRGDIIERALDLFSDNAPPPELVEILNEDVLKSTCEGSQLCVI
AVLPHILDTGAAGRNGYLEVMIKMAQKYKKKMWGWLWTEAGAQMELESALGIGGFGYPAM
AAINTRKMKFALLKGSFSETGIHEFLRELSVGRGSTATLGGGVMPKIHAVEPWDGKDGQL
PVEEDYDLSDVDLDEDFEKDEL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgcttttacttggagtgctgggctgctctctgctcctgtctgtggaggctttg
tactcccccagcgacgatgttgtggagctcacaccctccaacttcaacagagaggtgatg
cagagtgacagtctgtggctggtggagttttacgctccctggtgtggacactgtcgcaat
ctggctcctgactggaagaaggcagctactgctctcaagggaatcgtcaaggttggagct
gttgacgctgacgagcacaagtctctggggggacagtatggagtcagagggttccccacc
atcaagatctttggagctaataagaacaagccagaagagtaccaaggggctcgcagtagt
caggccattgtggatggagcaatgaacgccttacgttctctggtgaaagacagactcagc
ggcaagtccggcagctccggctacagcaggcagagtgatagtggcagcagtgggagcagc
aaggatgtggtggagctgactgatgacaactttgataagactgtactgcagagcgatgat
gtgtggttggtggagttcttcgccccctggtgtggacactgcaaaaatttggagcccgag
tgggcagctgcagccacagcagtgaaggagcagacgaagggtaaagttcgcctcggggcc
gtggatgctactgtgcatcaggttctgtccagtcgctatggggtccgtgggtttcccacc
atcaagattttccgtaaaggcgaggagccagaagactaccagggaggccgaacccgtgga
gatattattgagagggctttggatctgttctctgacaacgctcctcctcctgagctggtg
gagatcctcaatgaggacgtcctgaagagcacgtgtgagggcagccagctgtgtgttatt
gcagtgctgcctcacattttggatacaggtgcagctggcaggaacggctacttggaggtg
atgatcaagatggcacagaagtacaaaaagaagatgtggggctggctctggaccgaggcg
ggggctcagatggagctggagtccgctttgggcatcggcggctttggctaccctgccatg
gctgccatcaacacgcgcaagatgaaatttgctttgctcaaaggctctttcagtgagact
ggcatccatgagttcctcagggagctgtctgtgggccggggctccactgccacactggga
gggggtgttatgccaaagattcatgctgtggaaccctgggatggcaaagacggacagctt
cctgtggaagaggactacgacctaagcgacgtagacctggacgaagactttgagaaggat
gagttatga

DBGET integrated database retrieval system