KEGG   Oryzias latipes (Japanese medaka): 101171736Help
Entry
101171736         CDS       T02443                                 

Gene name
paics
Definition
(RefSeq) multifunctional protein ADE2
  KO
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    101171736 (paics)
Enzymes [BR:ola01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     101171736 (paics)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     101171736 (paics)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
4
AA seq 999 aa AA seqDB search
MERGAERQRGDDREAQEDPVERQWGEAEVLALVAAWDEIGTQHVAENRVTFELISERLRR
LSVVRTWRECQAKSRSLGLPNRKPDAAGPNYSPGVEGWEEGKGLRRRSCPSSAPVQMQEG
VKGRSRPSLPFTPNMAEEGGRHWTDDEVRALLCVWADRNIREHLKSTLRNKCIFQEIARQ
MQRKFGVVRNWKQCRTKYKNLKYDYKTAKSAHAATGSSVGSPGKYMKFFEEVEAILLNRG
LENGMEEMRSRLYNGEVGEESLQKADGTTAQNTDKEIVIEIDDDDNSVDYEIDGDADDQW
REVHLPHTDSPGSDQIHVVTMSDTGRNWSDQEVRALVQVWSDERICRQLESSTRKRDIFV
QISNRLMQQGIERDWKQCHTKYKNLKYLYRTLQRGKTDEADLRSNMRFYDEIDAIMKHSL
NGDAGAVDATNPVTARQGCEDDQRAEVCLRNPGGTDDKTCSSDSVSSTFSEVGKTANHLQ
LHPTNREHSEPLHRDTRIPDRETSSSANRGLKRKAADQDSSAHVVPKKLSPRLDKAETRC
KEEPDLIPIIKIKSVCSMASPAARRPERWGSCSAMASTPELNIGEKLNEGKTKQIFEIVD
QPGLVLVQSKDQITAGNAARKDQMEGKAAMANKTTSCVFRLLQESGIKTAFVKQHSDTAF
IAAHCEMIPIEWVCRRVATGSFLKRNPGVKEGFRFSPLKMEMFFKDDANNDPQWSEEQLL
EAKFCLSGLPIGRCEVDIMNRSTVAIFEILERAWATQDCTLVDMKIEFGVNVKTQEIVLA
DVIDNDSWRLWPSGDRSQQKDKQVYRDLKEVTPEAMQVVKRNFEWVAERVKMLLEPQVSG
RVVVLMGSTSDMAHCEKIKKACVSFGISCSLRVTSAHKGPDETLRIKAEYEGDGIPTVFV
AVAGRSNGLGPVMSGNSTYPVINCPPLTPDWGAQDVWSSLRMPSGLGCSTILSPEAAAQF
AAQIFGLTNHLVWSKVRASMLNTWVSLKQADQKLQACSL
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggagagaggagccgagagacaaaggggggatgatagggaggcgcaggaggacccggtg
gagaggcagtggggcgaagcagaggtgctggctctggtagcagcgtgggatgaaatagga
actcagcacgtagcagagaacagagtcacatttgaactgatctcagagcgtctgaggcgg
ctcagcgttgtgcgcacttggagggagtgtcaggccaagagcaggagcctgggacttccc
aacaggaagcctgacgcagcaggacccaactacagcccaggggtggagggctgggaagaa
ggaaagggtctccgaagacgaagctgcccttcctctgccccagtgcaaatgcaggaaggg
gtcaaaggtcgaagccgcccaagtcttccttttactccaaatatggctgaggagggaggc
cgccactggacagacgatgaggtgcgcgcgctcctgtgcgtctgggccgatcgaaacatt
cgggagcacctgaagagcacgctgcgcaacaagtgcatctttcaagaaatagcgcggcag
atgcagaggaagttcggggtggtgcgcaactggaagcagtgccggacaaaatacaagaac
ctcaagtacgactacaagacggccaaaagtgctcacgcagccacaggcagcagcgtggga
agccccggcaaatacatgaagtttttcgaagaggtggaggccatcctgctcaatagaggc
ctggaaaatgggatggaggaaatgaggagcaggttgtataacggagaagtgggagaagaa
agcctgcagaaggcagacggcaccacagcgcagaacacagacaaggagatagtgatagaa
atcgatgacgatgataacagtgttgattatgaaatcgacggagacgcagacgatcaatgg
agagaggtccacttgccccacacggattcccccggctccgatcagattcacgtggtcaca
atgtcagacacaggccgaaactggagcgaccaagaagtccgggcgctggttcaagtctgg
tctgatgagcgaatatgcaggcagctggagagctccaccagaaagagggacatctttgtc
cagatctccaacaggttaatgcagcaaggcatcgagcgcgactggaaacagtgccacacc
aagtacaagaacctcaagtatctttaccggacccttcagagggggaagacggacgaagcc
gacctgagaagcaacatgaggttctacgatgaaatagacgccataatgaaacactccttg
aacggggacgcaggagccgtggacgctacgaaccccgtcacggcgcggcagggctgtgag
gacgaccaacgggctgaggtgtgtttgaggaacccaggaggaacggacgacaaaacctgc
agctcagattcagtctcctccacattcagtgaagtcgggaaaaccgccaaccatctgcag
ctccatccaaccaacagagagcactctgagccactgcacagagacacaaggattcctgac
agagagacgagctcctcggccaacagagggctgaagaggaaagctgcagatcaagactct
tcggcccacgttgttccgaaaaaactcagccccagacttgataaagcagagacccgctgc
aaagaggagccggacctcatcccaataataaagatcaaatcggtctgctccatggccagt
ccagctgcaagaagaccggagcgttggggatcctgcagcgccatggcctccactccagag
ttaaacattggggagaagctcaatgaagggaagactaagcagatctttgaaatcgtggac
caacccggcctggtcctggtccagtccaaggaccagatcaccgccgggaacgcagcgagg
aaagaccaaatggagggaaaggctgccatggccaacaagacgacgagctgcgtcttccga
ctgctgcaggaatctggcattaagactgcttttgtgaagcagcactcggacacggccttc
attgcagcccactgtgagatgatccccattgagtgggtgtgccgcagagtggcgaccggc
tccttccttaagaggaatcctggagtcaaagagggctttcgtttctctcccctgaagatg
gaaatgtttttcaaagacgatgccaacaatgacccccagtggtctgaggagcagctgctg
gaggcgaagttttgcctgtctgggctcccgattggccggtgcgaggtggacatcatgaat
cgcagcactgtggccatctttgagattctggagagagcttgggccactcaggactgcact
ctggtggacatgaagatcgagtttggtgtaaatgtgaaaacccaggagattgtcctcgct
gatgtgatcgacaacgactcgtggaggctgtggccatcgggcgatcggagccagcagaag
gataagcaggtttacagagatttgaaggaagtcaccccagaagcgatgcaggtggtgaag
agaaactttgagtgggtggctgaaagggtgaagatgctgctggagccccaggtcagcggc
agagtggtggttctgatgggttccacttcagacatggctcattgtgaaaaaatcaagaag
gcttgtgtgtcctttgggatctcctgcagtttgcgggtgacctccgctcacaagggtcca
gacgagactctccgcatcaaagcagaatatgaaggtgatggcattcccactgtttttgtg
gctgtagctggcaggagtaacggcctcgggcccgttatgtccggaaactccacctatcct
gtcatcaattgcccgcctctcactcctgactggggagcacaagacgtgtggtcgtcgctc
cgcatgccgagcggtctcggatgctccaccatcctttctcctgaagctgctgctcagttc
gcagcacagatctttggcctgaccaatcatctggtttggtccaaagttcgggcctccatg
ctcaacacctgggtgtctctcaagcaggcagaccagaaattacaggcctgcagcctctga

DBGET integrated database retrieval system