KEGG   Oryzias latipes (Japanese medaka): 101172575Help
Entry
101172575         CDS       T02443                                 

Definition
histone-lysine N-methyltransferase SETMAR-like
Orthology
K11433  
histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101172575
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101172575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 296 aa AA seqDB search
MNALNKRMVDISDGLEDVPVLCKDPITPTFKYCPDNVQGPGCAVDPSEVTLPGCSCLSRS
CCPESCSCLQTGGQAYHATGALLDLNRTGSDYSSPVFECNALCSCSDSCSNRVVQKGLQL
SLEVFHTSNKGWGVRTLQQIPRGTFVCEYAGEVVSFVEARGRQLSQSAEENNYIIAVVEH
AGSGSVTETFVDPTRVGNVGRFLNHSCQPNLVMVPVRVHSVVPSLALFAARDVRTEEELT
FDYSGGCRKQQPAETTTTQSPAVAEASRPNGQQRKPCRCGAEKCTGFLPLDLSILY
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgttgaacaaacgcatggtggacatcagtgatggcttggaggatgttcctgtt
ttatgtaaagatccaataacccctacattcaagtattgtccggataatgtccagggaccg
ggctgtgcggttgacccctctgaggtcacccttcccggctgctcttgcctttcccgctcc
tgctgccccgagagctgctcctgcctgcagactggtgggcaggcgtaccacgccaccggt
gctttgctggacctcaacagaaccggctcggattactcttcacctgtgtttgagtgcaat
gccctttgcagctgcagtgactcctgctcgaatcgggtggtgcagaagggactgcagctc
agcttggaggttttccacaccagcaacaagggctggggagttcggacgctgcagcaaatt
ccccgtgggacattcgtgtgcgagtatgcaggggaggtggtcagctttgtggaggccagg
ggccggcagctgagccagagtgctgaggagaataattacatcatcgcggtggtggagcat
gcggggtcaggctctgtcactgaaacatttgtggacccgacccgggtgggaaatgtaggc
cgttttctcaaccactcctgccagcctaatctggttatggttcctgtgcgcgtgcactca
gtcgttcccagcctggcgctttttgctgcacgggacgtcagaactgaagaggagctgacg
tttgactattcaggaggatgcaggaagcagcagcctgcagagacgacgaccacgcaaagt
cctgctgtggcggaggccagccggccaaacggacagcagaggaaaccgtgccgctgtggt
gccgagaagtgcacaggcttcctgcctctggatttatccattctctactaa

DBGET integrated database retrieval system