KEGG   Oryzias latipes (Japanese medaka): 101172663Help
Entry
101172663         CDS       T02443                                 

Definition
N-lysine methyltransferase SETD8-A-like
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101172663
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101172663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 340 aa AA seqDB search
MAKGKKNVLRTNKKKEDSKEKIVTSQTETKENKPASNKTCKDKIQTYFQNLRSPSKPRSP
LSDSSSKLIQEDNDSETTDPEMARLKEEAESKIKDDGCESIEKKPDEPGQSCGAKEQTND
DLEKKESPKQAVGKSPTDGKVSESGHQIKASRKHRAKKVEKKVSQNKKVTDYFPIRRSNR
KTKGEIKSEEHRQIDDLINKNTEEGMEVRQIEGKGRGVFAVRAFKKGDFVVEYHGDLLDL
AEAKTREDQYAQDPQTGCYMYYFQYQSKSYCIDATKESGRLGRLVNHSKSGNCQTRLHAI
GETPHLILVASRDIKAGEELLYDYGDRSKESITAHPWLKF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagggaagaaaaatgtactgagaaccaacaaaaagaaagaagactcaaaggag
aaaatagtcacttcgcaaactgagacaaaggaaaacaaaccagcatctaacaagacctgc
aaagataaaatacagacatatttccagaatctgcgcagtccaagcaaacctagatcccct
ctgagtgacagttcaagtaaactgatccaggaggacaatgattctgaaacgactgaccct
gaaatggcaagactgaaggaagaagctgaaagcaaaatcaaggatgatggctgtgagtcc
attgagaaaaagcctgatgagcctggtcagagttgtggagcaaaagaacaaactaatgat
gatcttgaaaaaaaggagtctcctaaacaagcagttgggaagtctccaacagacggcaag
gtttcagaatctgggcatcaaatcaaagccagccgcaagcatcgagcaaaaaaggtggaa
aaaaaagtttctcaaaacaaaaaggtcacagactacttccccatcagacggagtaacagg
aaaactaaaggcgaaataaagagtgaggaacacagacagatcgatgatctgataaataaa
aacacagaagaaggaatggaggtcagacaaatagaaggaaaaggaagaggagtatttgct
gtgagagcgttcaaaaagggagactttgttgtggagtatcatggcgacctgctggactta
gccgaggctaaaacaagagaagatcagtacgctcaagatcctcaaacaggctgttacatg
tactacttccagtatcaatctaaaagttactgcatagacgccacaaaagaaagtggtcgt
cttgggaggctggtcaaccacagtaagagtggaaactgtcagaccaggcttcacgccatc
ggagaaaccccgcatctaatcttggtggcttctagagacatcaaagcaggagaggagctt
ctctatgactacggagatcggagtaaagagtccatcactgcgcacccttggctcaaattc
tga

DBGET integrated database retrieval system