KEGG   Oryzias latipes (Japanese medaka): 101172672Help
Entry
101172672         CDS       T02443                                 

Gene name
gbe1
Definition
(RefSeq) 1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00500  Starch and sucrose metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101172672 (gbe1)
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101172672 (gbe1)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101172672 (gbe1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 101172672
NCBI-ProteinID: XP_023817771
Position
13
AA seq 689 aa AA seqDB search
MADQEGSITVPDFSSLLQMDPYLKPFEQDLKRRHEHLQKLLFQLEETEGGFDQFTRSYRS
FGVQRQPDNSLFFKEWAPGAEALFLTGDFNDWNKFSHPYAKKEFGKWELILPPKHDGSPA
VDHNSKLKVVVHTNDGQRIYRISPWAKYVAREGKAVIYDWVHWDPPHPYIHIHPRPKKPT
SLRIYEAHVGIASPEPKVASYSNFTTNVLPRIKDLGYNCIQLMAIMEHVYYACFGYQITS
YFAASSRYGTPDELKQLIDVAHSMGIVVLLDVVHSHASKNTEDGLNRFDGTDSCFFHSPP
RGEHSLWDSRLFNYSSWEVLRFLLSNLRWWMEEYRFDGFRFDGVTSMLYHHHGIGTGFSG
DYNEYFGLHVDEDSLVYLMLANHILHTLYPDCITIAEDVSGMPALCRGVQEGGLGFDYRL
AMAIPDKWIQILKELKDEDWNMGDIAFTLTNRRYGEKCIAYAESHDQALVGDKTLAFWLM
DKEMYTNMSTLIPMSPIIDRGIQLHKMIRLLTHGLGGEGYLNFIGNEFGHPEWLDFPREG
NNQSYHYARRQFNLLDTDHLRYCQLYAFDRDMNRAEDKYGWLAAPPAFVSAKHEGDKVIV
FDRANVLFIFNFHPNRSFQDYRVGVEAAGKYKIKLDSDEVQYGGHGRLDHSTDFFTEPHP
FNGRSNSMLVYIPCRTAIVLANEEIDYCY
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccaagagggcagcatcaccgtccctgactttagctcccttctccaaatggac
ccttacctgaaacctttcgagcaggacctcaagaggaggcacgagcatctgcagaagctg
cttttccagctggaagagacagaggggggcttcgaccagttcactcgcagctaccggagc
ttcggagtgcaacggcagcccgacaacagcctcttcttcaaagagtgggcgccaggggcg
gaggccctcttcctcaccggggacttcaatgactggaataaattctcccacccctacgcc
aagaaggaatttggtaaatgggaactaattcttccgccaaagcatgacgggtccccagct
gtggatcataactccaaactcaaggtggttgttcacaccaatgatggccaacgcatctac
cggatctcgccttgggcaaaatatgtggcgagggaggggaaagctgtcatctacgactgg
gttcactgggatcctcctcacccttacatccatattcaccctcggccaaagaaacccaca
agtttgagaatatacgaggctcacgtgggcatcgcttcaccagagccaaaagtcgcctca
tattccaacttcacaacaaatgtgctgcctcgaataaaagacttgggttacaactgtatt
caacttatggctattatggagcatgtgtattacgcctgttttggatatcaaattacaagt
tactttgctgcttccagtcgttatgggactccggatgagttgaagcagctgatcgacgtg
gctcattcaatgggcattgtggtgctgctggacgtggttcacagtcacgcctccaagaac
acagaggacggcttgaaccgctttgatggcaccgactcttgtttctttcactcacccccc
agaggggagcactcactctgggacagccgcctcttcaactactccagctgggaagtgctg
cggttcctgctttcaaacttgcgttggtggatggaggagtaccgctttgatgggttccga
ttcgacggtgttacttccatgttgtaccatcaccatggcatcggcaccggcttctccggg
gactacaatgaatactttggcctccacgtggatgaagactctttggtttacctgatgctt
gccaatcacattcttcataccctttatccagactgcatcaccatcgcagaggatgtttca
gggatgccggcactctgcagaggagtgcaggagggaggactgggctttgattacagactg
gctatggccattcctgacaagtggatccagatcctgaaggagttaaaggatgaggactgg
aacatgggggatattgccttcactctgaccaacaggcgatatggagagaagtgcattgcc
tatgcagaaagccacgatcaggctctggttggtgacaaaacgctggccttttggttgatg
gacaaggaaatgtacaccaacatgagcaccttgattcccatgtcgcccatcatcgaccgc
gggatccaactgcacaaaatgatccgcctgcttactcatggtctcgggggagaaggctac
ctaaactttatcggaaatgagtttggccatccagagtggctggatttccccagggaaggc
aacaatcagagttaccactatgcccgacggcagtttaacctgttggatacggatcacctc
cgctactgccagctctacgcctttgaccgggacatgaaccgcgccgaagacaagtacggc
tggctggcagctccacctgcctttgttagcgccaagcatgaaggggacaaggtcattgtg
tttgacagggcaaacgtgctctttatcttcaacttccaccccaacagaagcttccaggac
tacagggtcggtgtagaagctgcaggaaaatacaaaatcaagctggattcagacgaggtt
cagtatggaggacacggacgcctcgaccacagcacggacttcttcacagaacctcatccc
ttcaacggccgctccaactccatgctggtctacatcccctgcagaacagctattgtcctg
gccaacgaagagatagattactgttattag

DBGET integrated database retrieval system