KEGG   Oryzias latipes (Japanese medaka): 101172672Help
Entry
101172672         CDS       T02443                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101172672
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101172672
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101172672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 662 aa AA seqDB search
MDPYLKPFEQDLKRRHEHLQKLLFQLEETEGGFDQFTRSYRSFGVQRQPDNSLFFKEWAP
GAEALFLTGDFNDWNKFSHPYAKKEFGKWELILPPKHDGSPAVDHNSKLKVVVHTNDGQR
IYRISPWAKYVAREGKAVIYDWVHWDPPHPYIHIHPRPKKPTSLRIYEAHVGIASPEPKV
ASYSNFTTNVLPRIKDLGYNCIQLMAIMEHVYYACFGYQITSYFAASSRYGTPDELKQLI
DVAHSMGIVVLLDVVHSHASKNTEDGLNRFDGTDSCFFHSPPRGEHSLWDSRLFNYSSWE
VLRFLLSNLRWWMEEYRFDGFRFDGVTSMLYHHHGIGTGFSGDYNEYFGLHVDEDSLVYL
MLANHILHTLYPDCITIAEDVSGMPALCRGVQEGGLGFDYRLAMAIPDKWIQILKELKDE
DWNMGDIAFTLTNRRYGEKCIAYAESHDQALVGDKTLAFWLMDKEMYTNMSTLIPMSPII
DRGIQLHKMIRLLTHGLGGEGYLNFIGNEFGHPEWLDFPREGNNQSYHYARRQFNLLDTD
HLRYCQLYAFDRDMNRAEDKYGWLAAPPAFVSAKHEGDKVIVFDRANVLFIFNFHPNRSF
QDYRVGVEAAGKYKIKLDSDEVQYGGHGRLDHSTDFFTEPHPFNGRSNSMLVNISNMTFL
TH
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggacccttacctgaaacctttcgagcaggacctcaagaggaggcacgagcatctgcag
aagctgcttttccagctggaagagacagaggggggcttcgaccagttcactcgcagctac
cggagcttcggagtgcaacggcagcccgacaacagcctcttcttcaaagagtgggcgcca
ggggcggaggccctcttcctcaccggggacttcaatgactggaataaattctcccacccc
tacgccaagaaggaatttggtaaatgggaactaattcttccgccaaagcatgacgggtcc
ccagctgtggatcataactccaaactcaaggtggttgttcacaccaatgatggccaacgc
atctaccggatctcgccttgggcaaaatatgtggcgagggaggggaaagctgtcatctac
gactgggttcactgggatcctcctcacccttacatccatattcaccctcggccaaagaaa
cccacaagtttgagaatatacgaggctcacgtgggcatcgcttcaccagagccaaaagtc
gcctcatattccaacttcacaacaaatgtgctgcctcgaataaaagacttgggttacaac
tgtattcaacttatggctattatggagcatgtgtattacgcctgttttggatatcaaatt
acaagttactttgctgcttccagtcgttatgggactccggatgagttgaagcagctgatc
gacgtggctcattcaatgggcattgtggtgctgctggacgtggttcacagtcacgcctcc
aagaacacagaggacggcttgaaccgctttgatggcaccgactcttgtttctttcactca
ccccccagaggggagcactcactctgggacagccgcctcttcaactactccagctgggaa
gtgctgcggttcctgctttcaaacttgcgttggtggatggaggagtaccgctttgatggg
ttccgattcgacggtgttacttccatgttgtaccatcaccatggcatcggcaccggcttc
tccggggactacaatgaatactttggcctccacgtggatgaagactctttggtttacctg
atgcttgccaatcacattcttcataccctttatccagactgcatcaccatcgcagaggat
gtttcagggatgccggcactctgcagaggagtgcaggagggaggactgggctttgattac
agactggctatggccattcctgacaagtggatccagatcctgaaggagttaaaggatgag
gactggaacatgggggatattgccttcactctgaccaacaggcgatatggagagaagtgc
attgcctatgcagaaagccacgatcaggctctggttggtgacaaaacgctggccttttgg
ttgatggacaaggaaatgtacaccaacatgagcaccttgattcccatgtcgcccatcatc
gaccgcgggatccaactgcacaaaatgatccgcctgcttactcatggtctcgggggagaa
ggctacctaaactttatcggaaatgagtttggccatccagagtggctggatttccccagg
gaaggcaacaatcagagttaccactatgcccgacggcagtttaacctgttggatacggat
cacctccgctactgccagctctacgcctttgaccgggacatgaaccgcgccgaagacaag
tacggctggctggcagctccacctgcctttgttagcgccaagcatgaaggggacaaggtc
attgtgtttgacagggcaaacgtgctctttatcttcaacttccaccccaacagaagcttc
caggactacagggtcggtgtagaagctgcaggaaaatacaaaatcaagctggattcagac
gaggttcagtatggaggacacggacgcctcgaccacagcacggacttcttcacagaacct
catcccttcaacggccgctccaactccatgctggtaaatatttccaatatgacatttttg
actcattaa

DBGET integrated database retrieval system