KEGG   Oryzias latipes (Japanese medaka): 101172677Help
Entry
101172677         CDS       T02443                                 

Definition
3-methyl-2-oxobutanoate dehydrogenase [lipoamide] kinase-like
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
ola  Oryzias latipes (Japanese medaka)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 428 aa AA seqDB search
MRSGLAGLVAEMLCGVTGGTRPRLRSLLLAPATKTLPPVSAAGSRRFRSTSSMQGFSEMA
RERSKTVTSFYNQSAIDVSAEKASVRLTLATLLYSGKSPDGHHILSSARYLHKELPVRIA
HRIKGFRSLPFIIGCNPTILQVHELYIRAYHMLSEFPQIKEQDMEARFCKLVQQLLDDHK
DVVTMLAQGFRECRRHIQDETIIRSFLDTTLCSRLGIRMLATHHLALHEDNPDFVGIICR
RLSPKKIIEKWVDFARRLCEHQYGNSPRVRINGHVAARFPFIPLPLDYILPELLKNAMRA
TMESHLDTPYNVPDVVVTIANNDIDFVIRISDRGGGIPHNILDKVMDYHFSTAEESAQDP
RMSNLFNNITNSGNQSSPMHGFGFGLPTSRAYAEYLGGSLSVQSMQGIGTDVYLRLRHID
GKGESFRV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcaggtttagcgggactcgtggcggagatgctgtgcggtgttaccggcggaacc
cggccgaggctccgcagcctcttactggcccccgctaccaaaacattgcctccggtgtca
gctgctggaagccgaagatttcggtccacatcctcgatgcaaggattttcagagatggcg
agggagcggtcgaagactgtcacgtctttttacaaccagtctgcaatcgacgtttcagca
gaaaaggcctcagtgcgtctaaccttagcaaccttgctgtactctggaaagtctcctgat
ggacaccacatcttgagcagtgccaggtatcttcacaaggagcttcctgtaagaattgct
catcggatcaagggtttccgcagtttgccattcatcattggctgtaaccccaccatactg
caagtgcatgaactgtacatcagagcctaccacatgctgagcgagttcccccagatcaaa
gagcaggacatggaggcgcgtttctgcaagctggtgcagcagctgctggacgaccacaaa
gacgtggtcaccatgctggcccagggcttcagggagtgtcggcgacacatccaggatgag
acgatcattcgcagcttcttggacacaacgctgtgctctcgtctcggcatccgaatgttg
gccactcatcatctggctctgcatgaggacaatccggattttgttggaatcatatgcaga
cgtctttctcctaaaaaaattatagagaagtgggtggactttgccagacgtctgtgtgag
catcagtatggaaattcacccagagtgaggatcaatggacacgtagccgctcgcttcccc
ttcatccctttgcctctggattatatcctaccagaactccttaaaaatgccatgagggcc
accatggaaagccacctggacactccttacaacgtacccgatgtggttgtcactattgcg
aacaatgacatcgactttgtcataaggatttcggaccgcggtggaggcattcctcacaat
atactggacaaagtgatggactaccacttcagcacggcggaggagagcgctcaggacccc
cgcatgagcaacttattcaacaacatcaccaacagcgggaatcagtccagccccatgcac
gggtttggcttcggcctgcccacatccagagcctatgccgagtacctggggggctccctg
tccgtacagtctatgcagggcatcggcactgacgtttacctccgcctgcgccacatcgac
ggcaaaggggagagcttcagagtgtaa

DBGET integrated database retrieval system