KEGG   Oryzias latipes (Japanese medaka): 101172698Help
Entry
101172698         CDS       T02443                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1-like
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
GnRH signaling pathway
Melanogenesis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101172698
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101172698
   04020 Calcium signaling pathway
    101172698
   04070 Phosphatidylinositol signaling system
    101172698
 Cellular Processes
  Cell communication
   04540 Gap junction
    101172698
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    101172698
   04916 Melanogenesis
    101172698
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101172698
   04270 Vascular smooth muscle contraction
    101172698
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101172698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
24
AA seq 1183 aa AA seqDB search
MSRRSSHVDTLQLVAGTIKARLKKHLERHKDAKLREVLDISTLVGKLENRMLTVVSGTDM
VNITYLNFMAFQEEIAKEWAEELFKLASNLLVQNSSRETCLEKVYTRLKLQLNPEGRIPV
KNIFRIFSADRKRVETALESCNLPSGRPRVYSYNCKIPSHYHHTCCERRGVAFSGAKSRP
YLTVEQMTEFINSKQRDPRLNEILYPPLKAEQVQVLVDKYEPNASLAQKGQMSVEGFSRY
LNGEENSIIPPEKLDQSEDMTFPLSHYFINSSHNTYLTAGQLAGNSSVEMYKQVLLSGCR
CIELDCWKGRTTEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPIILSFENHVDSP
KQQAKMAEYCRSIFGDALLMEPLEKYQLEAGVPLPSPMELMGKILIKNKKKHHKANGSTK
KKLSEQVSNTYSDSSSVCEPSSPSAGSTKEEPEPPQPCEAAELVLRAQSRKSIGEVEAES
DEEDDDDDDCKKGSMDEGTAGSEAFATEEMSNLVLYIQPVKFHSFETSKKINRSYQMSSF
VETKALEQLTKCPVEFVEYNKLQLSRIYPKGTRVDSSNYNPQLFWNAGCQLVALNFQTVD
LSMQLNLGMFEYNGKCGYRLKPEFMRRPDKHFDPFTESTVDGIVANTLSVKILSGQFLSD
KKVGTYVEIDMFGLPVDTKRKAFKTKTSQGNAINPVWEEEAIVFKKVVLPTLASLRIAVF
EEGGKFIGHRIFPASAIRPGYHYINLRNEKNQLLTLPSLFVYVEVKDYVPDTFADVIEAL
SNPIRYVNLMEQRANQLAALTLEEGGEEEGDKEVEAGSDAPTESKVDRGVVQPAENGLET
PIIPSKPPSLVGPTQSAGSLKPAAKTEDIIQSVLTELEAHTVEELKQQKSFVREQRKQYK
EMKELVRKHHRKTGEMIKEHTARISELQGQHQRRRSALQKSYKRDGKKSQSEHSLSSLDQ
ELTELDQECNQRLAELKEQQQQQLLTLRQEQYYSEKYQKREHIKQLVEKLTGLAEECQSA
QLKKLRDICEKEKKDLKKRMDKRRQEKITEAKSKDKNVTEEEKLEINRSFVNEVVQYIKR
LEDAQSKRQERLQDKHKDVRQQILDERPKLQSDLDQEYQDKFRRLPVEIQEFVQDSSKAK
QSGDFIHGSLVSSSTAEKLNHKASQSEDETEEGSSEHVYDTAL
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggcgaagctcacatgtcgacacgctgcagctggtagcgggcaccatcaaggct
cgactgaagaaacacttggagaggcacaaagacgctaaactccgtgaggtgctggacatc
agcaccctggtggggaagttggaaaacaggatgctgacggtggtgagcggcacggacatg
gttaacatcacctatctgaacttcatggcctttcaggaggagatcgcaaaggaatgggca
gaggagctcttcaagctggcatcaaacctgctggtgcaaaactcttcaagagagacctgc
ctggagaaggtatacactcgactgaagctgcagctcaaccctgagggacgaatccctgtc
aagaatatcttcaggatattctcagcagacaggaagcgagtggagacagctctggaaagc
tgtaacctcccttctggcagacctcgtgtgtacagttataactgtaagattccttctcac
taccatcacacctgttgcgagcggcggggtgtggccttcagcggggcgaagagtcgaccg
tacctcaccgtggagcagatgaccgagttcatcaacagcaaacagcgggaccctcgtctg
aatgagatcctctacccccccctcaaggcggagcaggttcaggttctggtggacaaatac
gaacccaacgcttctttggcacagaaaggtcaaatgtcggtggaaggcttctccaggtac
ctgaatggagaagagaacagcatcattcccccagagaagctggaccagagtgaagacatg
accttccctctttcccattacttcatcaactcctcacataacacatacctcacagcgggc
cagcttgcaggaaactcttcggtggagatgtacaaacaggtcctgctgtccgggtgccgc
tgcatcgagctcgactgctggaagggtcgcaccacggaagaggagcccgtcatcacccac
ggcttcaccatgaccacggaaatctccttcaaggaagtgatagaagcgatcgctgagtgt
gccttcaagacctcacctttccccatcatcctgtcttttgagaaccacgtggactcaccc
aagcagcaggctaagatggcagagtactgccggtcgatatttggagacgcgttgctgatg
gagcctctggagaaatatcagctggaagcaggagttccactgcccagccccatggagctg
atgggaaaaatactgatcaagaacaaaaagaaacaccacaaagctaacggaagcaccaag
aaaaagctctccgagcaggtttctaacacctacagcgactcttccagcgtgtgtgagccg
tcctctccgagcgcgggttcaaccaaagaggaaccagagcccccccagccctgtgaggcc
gctgagcttgtgctgagagcccagagcaggaagtccatcggtgaagtggaggctgaaagt
gacgaggaagacgacgacgatgacgactgtaaaaaaggctcgatggatgagggcacagca
ggcagcgaggcctttgccacagaagaaatgtccaacttggtcctttacatccagcctgtc
aagtttcacagctttgagacttctaaaaagatcaaccgcagttaccagatgtcgtcgttt
gtggagaccaaagctttggagcagctgaccaagtgtcccgtcgagtttgtggaatacaac
aagctgcagctcagcaggatctacccgaaaggcacccgggtggattcatccaactacaac
cctcagctcttctggaatgccggctgtcagctggtggcgctgaacttccagaccgttgat
ttatccatgcagctgaacctaggaatgtttgagtataacgggaagtgcggctacagactc
aaaccggagttcatgaggagaccggataagcactttgaccctttcaccgagagcactgtg
gacgggattgtcgccaacacgctgtcggttaagatcctctcaggtcagttcttgtctgat
aaaaaggtaggaacatacgtggagatcgacatgttcggcctgccggttgacaccaagagg
aaagcgttcaagaccaagacgtctcagggcaacgccatcaacccggtctgggaagaggag
gccatcgtgtttaagaaggttgtcctccccacgctggcttctctgaggattgcagtgttt
gaggaaggagggaagttcatcggccaccgcatctttcctgcatctgccatccgtccaggt
tatcactacatcaacctgaggaatgagaagaaccagttgctgacattaccgtccctgttc
gtttacgtggaagtgaaggactacgtccccgacacctttgcagacgtcatagaagcgctg
tccaatccgatacgctatgtcaacctgatggagcagagagccaatcagctggctgctctc
actctggaggaaggaggcgaggaagagggcgacaaagaggtggaggcaggaagtgatgcc
cccacagaatccaaagtggaccgtggggtcgtgcagcctgcagaaaatggactggagacg
cccatcatcccctccaaaccgccctcattggtcggcccgactcagtctgcaggttcgctg
aagccggcggcgaagactgaagacatcatacagagcgtcctcacggagttggaggctcac
acggtggaggagttaaagcagcagaagagttttgttcgggagcagcggaagcagtacaag
gagatgaaggagctggtccgcaaacaccaccgcaagaccggcgagatgatcaaggagcac
acggcccgcatctccgagctccagggccagcatcagcgcaggaggtcggccctgcagaag
agttataaacgagacggtaagaaaagtcagtctgaacactccctgtcgtctctggaccaa
gagctgacggagctggatcaagagtgcaaccagcggctggctgagctgaaggagcagcag
cagcagcagctcctcaccctccgtcaggagcaatactacagcgaaaagtaccagaaacgg
gagcacataaagcagctggttgaaaaactgacgggtttagctgaagaatgccagagtgct
cagctcaaaaagctcagagacatctgtgaaaaagaaaagaaggatctcaagaagaggatg
gacaagagaagacaagagaagatcactgaggccaaatccaaagacaagaatgtgacagaa
gaagagaagttggagatcaacagatcctttgtgaatgaggtggtgcagtacatcaagagg
ttggaggacgctcagagcaaaagacaggagaggctgcaggacaaacacaaggacgttcgg
cagcaaatcctggacgaaaggccaaagttgcagagcgatctggaccaggagtaccaggac
aagtttcgccggctacccgttgagatccaagagttcgtccaggacagcagcaaggccaaa
caaagcggcgactttatccacgggagcctcgtttcctcctcgacagccgagaaactcaac
cacaaggcgtcgcagtccgaggacgaaaccgaggagggctcgtcagaacacgtctacgac
acggctctttag

DBGET integrated database retrieval system