KEGG   Oryzias latipes (Japanese medaka): 101172698Help
Entry
101172698         CDS       T02443                                 

Gene name
plcb1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Apelin signaling pathway
Gap junction
NOD-like receptor signaling pathway
GnRH signaling pathway
Melanogenesis
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101172698 (plcb1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101172698 (plcb1)
   04371 Apelin signaling pathway
    101172698 (plcb1)
   04020 Calcium signaling pathway
    101172698 (plcb1)
   04070 Phosphatidylinositol signaling system
    101172698 (plcb1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    101172698 (plcb1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    101172698 (plcb1)
  Endocrine system
   04912 GnRH signaling pathway
    101172698 (plcb1)
   04916 Melanogenesis
    101172698 (plcb1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101172698 (plcb1)
   04270 Vascular smooth muscle contraction
    101172698 (plcb1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101172698 (plcb1)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101172698 (plcb1)
Membrane trafficking [BR:ola04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101172698 (plcb1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101172698 (plcb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
24
AA seq 1242 aa AA seqDB search
MAGAQPGVHALQLKPVCVPECLKKGNKFMKWEDDSTAVTPVTLTVDPKGYFLYWTDQNKD
TDLLDVAFIKDARNGKFCKMPKDAKLREVLDISTLVGKLENRMLTVVSGTDMVNITYLNF
MAFQEEIAKEWAEELFKLASNLLVQNSSRETCLEKVYTRLKLQLNPEGRIPVKNIFRIFS
ADRKRVETALESCNLPSGRNESIPQEDFTPEVYSMFLSNICPRPELDHIFSEIGAKSRPY
LTVEQMTEFINSKQRDPRLNEILYPPLKAEQVQVLVDKYEPNASLAQKGQMSVEGFSRYL
NGEENSIIPPEKLDQSEDMTFPLSHYFINSSHNTYLTAGQLAGNSSVEMYKQVLLSGCRC
IELDCWKGRTTEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPIILSFENHVDSPK
QQAKMAEYCRSIFGDALLMEPLEKYQLEAGVPLPSPMELMGKILIKNKKKHHKANGSTKK
KLSEQVSNTYSDSSSVCEPSSPSAGSTKEEPEPPQPCEAAELVLRAQSRKSIGEVEAESD
EEDDDDDDCKKGSMDEGTAGSEAFATEEMSNLVLYIQPVKFHSFETSKKINRSYQMSSFV
ETKALEQLTKCPVEFVEYNKLQLSRIYPKGTRVDSSNYNPQLFWNAGCQLVALNFQTVDL
SMQLNLGMFEYNGKCGYRLKPEFMRRPDKHFDPFTESTVDGIVANTLSVKILSGQFLSDK
KVGTYVEIDMFGLPVDTKRKAFKTKTSQGNAINPVWEEEAIVFKKVVLPTLASLRIAVFE
EGGKFIGHRIFPASAIRPGYHYINLRNEKNQLLTLPSLFVYVEVKDYVPDTFADVIEALS
NPIRYVNLMEQRANQLAALTLEEGGEEEGDKEVEAGSDAPTESKVDRGVVQPAENGLETP
IIPSKPPSLVGPTQSAGSLKPAAKTEDIIQSVLTELEAHTVEELKQQKSFVREQRKQYKE
MKELVRKHHRKTGEMIKEHTARISELQGQHQRRRSALQKSYKRDGKKSQSEHSLSSLDQE
LTELDQECNQRLAELKEQQQQQLLTLRQEQYYSEKYQKREHIKQLVEKLTGLAEECQSAQ
LKKLRDICEKEKKDLKKRMDKRRQEKITEAKSKDKNVTEEEKLEINRSFVNEVVQYIKRL
EDAQSKRQERLQDKHKDVRQQILDERPKLQSDLDQEYQDKFRRLPVEIQEFVQDSSKAKQ
SGDFIHGSLVSSSTAEKLNHKASQSEDETEEGSSEHVYDTAL
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
atggccggggcacagcctggagttcacgcgctgcagctcaagcccgtgtgcgtgccggag
tgcctcaagaagggcaacaaattcatgaaatgggaagatgattctacggcagtgaccccg
gtgacccttacagttgacccaaaaggctacttcctgtactggacggaccaaaacaaggac
acagacctgctggatgtagcgttcataaaagatgccagaaacggaaagttctgtaaaatg
ccaaaggacgctaaactccgtgaggtgctggacatcagcaccctggtggggaagttggaa
aacaggatgctgacggtggtgagcggcacggacatggttaacatcacctatctgaacttc
atggcctttcaggaggagatcgcaaaggaatgggcagaggagctcttcaagctggcatca
aacctgctggtgcaaaactcttcaagagagacctgcctggagaaggtatacactcgactg
aagctgcagctcaaccctgagggacgaatccctgtcaagaatatcttcaggatattctca
gcagacaggaagcgagtggagacagctctggaaagctgtaacctcccttctggcagaaac
gagtccatcccccaggaggactttaccccagaggtttacagcatgttcctgagcaacatc
tgcccccgacctgagttggaccacatcttctctgaaatcggggcgaagagtcgaccgtac
ctcaccgtggagcagatgaccgagttcatcaacagcaaacagcgggaccctcgtctgaat
gagatcctctacccccccctcaaggcggagcaggttcaggttctggtggacaaatacgaa
cccaacgcttctttggcacagaaaggtcaaatgtcggtggaaggcttctccaggtacctg
aatggagaagagaacagcatcattcccccagagaagctggaccagagtgaagacatgacc
ttccctctttcccattacttcatcaactcctcacataacacatacctcacagcgggccag
cttgcaggaaactcttcggtggagatgtacaaacaggtcctgctgtccgggtgccgctgc
atcgagctcgactgctggaagggtcgcaccacggaagaggagcccgtcatcacccacggc
ttcaccatgaccacggaaatctccttcaaggaagtgatagaagcgatcgctgagtgtgcc
ttcaagacctcacctttccccatcatcctgtcttttgagaaccacgtggactcacccaag
cagcaggctaagatggcagagtactgccggtcgatatttggagacgcgttgctgatggag
cctctggagaaatatcagctggaagcaggagttccactgcccagccccatggagctgatg
ggaaaaatactgatcaagaacaaaaagaaacaccacaaagctaacggaagcaccaagaaa
aagctctccgagcaggtttctaacacctacagcgactcttccagcgtgtgtgagccgtcc
tctccgagcgcgggttcaaccaaagaggaaccagagcccccccagccctgtgaggccgct
gagcttgtgctgagagcccagagcaggaagtccatcggtgaagtggaggctgaaagtgac
gaggaagacgacgacgatgacgactgtaaaaaaggctcgatggatgagggcacagcaggc
agcgaggcctttgccacagaagaaatgtccaacttggtcctttacatccagcctgtcaag
tttcacagctttgagacttctaaaaagatcaaccgcagttaccagatgtcgtcgtttgtg
gagaccaaagctttggagcagctgaccaagtgtcccgtcgagtttgtggaatacaacaag
ctgcagctcagcaggatctacccgaaaggcacccgggtggattcatccaactacaaccct
cagctcttctggaatgccggctgtcagctggtggcgctgaacttccagaccgttgattta
tccatgcagctgaacctaggaatgtttgagtataacgggaagtgcggctacagactcaaa
ccggagttcatgaggagaccggataagcactttgaccctttcaccgagagcactgtggac
gggattgtcgccaacacgctgtcggttaagatcctctcaggtcagttcttgtctgataaa
aaggtaggaacatacgtggagatcgacatgttcggcctgccggttgacaccaagaggaaa
gcgttcaagaccaagacgtctcagggcaacgccatcaacccggtctgggaagaggaggcc
atcgtgtttaagaaggttgtcctccccacgctggcttctctgaggattgcagtgtttgag
gaaggagggaagttcatcggccaccgcatctttcctgcatctgccatccgtccaggttat
cactacatcaacctgaggaatgagaagaaccagttgctgacattaccgtccctgttcgtt
tacgtggaagtgaaggactacgtccccgacacctttgcagacgtcatagaagcgctgtcc
aatccgatacgctatgtcaacctgatggagcagagagccaatcagctggctgctctcact
ctggaggaaggaggcgaggaagagggcgacaaagaggtggaggcaggaagtgatgccccc
acagaatccaaagtggaccgtggggtcgtgcagcctgcagaaaatggactggagacgccc
atcatcccctccaaaccgccctcattggtcggcccgactcagtctgcaggttcgctgaag
ccggcggcgaagactgaagacatcatacagagcgtcctcacggagttggaggctcacacg
gtggaggagttaaagcagcagaagagttttgttcgggagcagcggaagcagtacaaggag
atgaaggagctggtccgcaaacaccaccgcaagaccggcgagatgatcaaggagcacacg
gcccgcatctccgagctccagggccagcatcagcgcaggaggtcggccctgcagaagagt
tataaacgagacggtaagaaaagtcagtctgaacactccctgtcgtctctggaccaagag
ctgacggagctggatcaagagtgcaaccagcggctggctgagctgaaggagcagcagcag
cagcagctcctcaccctccgtcaggagcaatactacagcgaaaagtaccagaaacgggag
cacataaagcagctggttgaaaaactgacgggtttagctgaagaatgccagagtgctcag
ctcaaaaagctcagagacatctgtgaaaaagaaaagaaggatctcaagaagaggatggac
aagagaagacaagagaagatcactgaggccaaatccaaagacaagaatgtgacagaagaa
gagaagttggagatcaacagatcctttgtgaatgaggtggtgcagtacatcaagaggttg
gaggacgctcagagcaaaagacaggagaggctgcaggacaaacacaaggacgttcggcag
caaatcctggacgaaaggccaaagttgcagagcgatctggaccaggagtaccaggacaag
tttcgccggctacccgttgagatccaagagttcgtccaggacagcagcaaggccaaacaa
agcggcgactttatccacgggagcctcgtttcctcctcgacagccgagaaactcaaccac
aaggcgtcgcagtccgaggacgaaaccgaggagggctcgtcagaacacgtctacgacacg
gctctttag

DBGET integrated database retrieval system