KEGG   Oryzias latipes (Japanese medaka): 101172913Help
Entry
101172913         CDS       T02443                                 

Definition
probable histone deacetylase 1-B-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Cell cycle
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:ola04330]
Cellular Processes; Cell growth and death; Cell cycle [PATH:ola04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 482 aa AA seqDB search
MALSQGTKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAS
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAG
AVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPIMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYIKGFNLPLLMLGG
GGYTIRNVARCWTFETAVALDSSIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTTEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAPHPDSGDEDEADPDKRISIRAHDKRIACEEEF
SESEDEAEGQGGGRRNAANHKKSKRVKKEDEKEGEEIKEVKEEEKEEEKMDTSGPKEEAK
TT
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgagtcaaggaacaaagaagaaagtttgctactactacgatggcgatgtggga
aactattactacggccaagggcatcccatgaaaccccacaggatccgcatgacccacaac
cttctcctcaactatggactgtacaggaagatggagatctatagaccccacaaagccagt
gcggaggagatgaccaagtaccacagtgacgactacatcaagttcctgcggtccatccgc
ccggacaacatgtcagagtacagcaagcagatgcagagatttaacgttggagaggactgt
cccgtgtttgatggcctgttcgagttctgtcagctctccactggaggctctgttgctgga
gcggtgaagctgaacaagcagcagacagacatcgccatcaactgggccggcggcctccac
cacgccaagaagtctgaggcgtctggattctgctatgtcaacgacatcgtcctggctatc
ctggagctgctgaaatatcatcagagggtgctgtacatagacattgacatccaccatggc
gatggggtggaggaggccttctacaccacagaccgggtcatgaccgtctccttccacaag
tatggggagtacttccctggcaccggagacctgagggacattggagctgggaaggggaag
tactacgcggtcaactaccctctgagagacggcattgacgacgagtcctatgaagccatc
ttcaaaccgatcatggctaaagtgatggagatgtaccagcccagcgcggtggtcctgcag
tgtggagcagactctctgtctggagacaggctgggctgctttaatctcaccatcaaaggc
catgccaagtgtgtggagtacataaaaggcttcaacctccccctgctgatgctgggcgga
ggcggctacaccatccgcaacgtggcccgctgctggacctttgaaaccgccgtggcgctg
gactcctccatccccaacgagctgccctacaacgattactttgaatacttcggccctgat
tttaagctccacatcagcccctccaacatgaccaaccagaacaccaccgagtacctggag
aagatcaagcagcggctctttgaaaacctgcgcatgctgcctcacgcgcccggagtccag
atgcaggcgatcccagaggatgctccccacccagacagcggggacgaggacgaggcggac
cccgacaaacgcatctccatccgagcccacgacaagaggatcgcctgcgaggaggagttc
tccgagtctgaggacgaggcggaggggcagggaggaggccggaggaacgcggccaaccac
aagaagtccaaacgagtgaagaaggaggacgagaaggaaggagaggaaatcaaagaagtg
aaagaagaagaaaaggaagaggagaaaatggacacatcaggaccaaaagaagaagcaaag
accacctga

DBGET integrated database retrieval system