KEGG   Oryzias latipes (Japanese medaka): 101173208Help
Entry
101173208         CDS       T02443                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3-A-like
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101173208
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101173208
   04070 Phosphatidylinositol signaling system
    101173208
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101173208
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101173208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 770 aa AA seqDB search
MLGARRKDAGKSETTAIDPLRNLGIQEDEDVKKMLQGSSMVKVRSPRWQKRRTLRLLEDG
VTVWCQSHKSSSRAKEQQSFSVMEVECVREGCQLEALRHMTGSESTKRCLTVVFKGPRKS
LELLCQSEEEAQQWARGIRTLQERMDNMTHKEKLDHWIHAYLSRADENHDDKMSYEEVQR
LLRMINVDLSDQYARSLFQKCDHSADGRLDHEEIEVFCRELLRRPELDTIFIQHSANGCV
LSTVDLRDFLKKQEEDCSVTHAQSLILTYELNEWAQKNHLMTPNGFTMYMLSKQNCVFNP
DHARVYQDMTQPLAHYFISSSHNTYLTKDQMTGDSSTEPYIRALSHGCRCVELDCWDGDG
GEPVIYHGHTLTSKVPFVDVIKIINEYAFKASSFPLILSLENHCSVEQQAVMARHLRSIL
GEKLLQRPLSTEKSKCLPSPEDLKGKILVKGKREESAEECSSSSSDLNSSDDETSVAEGR
SKKKKDGKKAGVSKLNPELSELVVYTRSVHFKGFDQAAKSSPLQMSSFSEREALKLIKDS
GVLFVRHNSHKLSRIYPSGQRLQSSNYNPQQMWNAGCQIVALNFQTPGELMDLNQGRFLQ
NGLCGYVLKPPFMCTPDSTFNPENVGGGPGHRPILLTIRVISAQQLPKPECDKPSSIVDP
QVWVEIHGVPIDNNKEKTHYVENNGFNPQWNCTLNFTVHVPDLALVRFMVEDHDYTSSND
FLGQYTLPFTSMRSGYRHVPLFKLDGSSLSPSALFIHVKFSTCQSSPSRS
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgctgggagccaggaggaaagacgccgggaagtccgagacgacggccatcgacccccta
agaaacctcggaatccaggaggatgaggatgtgaagaagatgctgcagggctccagcatg
gtgaaggttcgctccccacgttggcagaagcgcaggactctgcggctgctggaggatgga
gtcactgtgtggtgccagtcacacaaatcatccagccgggccaaagagcaacaatccttc
tctgtcatggaggtggagtgtgttcgcgaaggctgccagttggaggcactgcgccacatg
acgggctccgaatccacgaagcggtgtttgacagtggttttcaagggaccacgtaagagt
ctagaactcctctgccagagcgaggaggaggctcagcagtgggcccgtggcatcaggacc
ctgcaggagcggatggacaatatgacccacaaggagaaactagaccattggattcatgct
tacctgagccgggcagacgagaaccatgacgacaagatgagctacgaggaggtgcaaaga
ctgctgcgcatgatcaacgtggacctgagcgatcagtacgcccgcagccttttccagaaa
tgtgatcactctgctgatggccgcctggaccatgaagagattgaagtcttctgcagggag
ctgttacgaagaccagaactggacaccattttcatccagcactcggcaaacggctgcgtg
ctctccactgtggacttgagggacttcctaaagaagcaggaggaggactgctctgtgact
cacgcccagagcctcatccttacctacgagctcaacgagtgggcccagaagaaccatctg
atgactcccaatgggtttaccatgtacatgctgtccaagcagaactgtgtattcaatcca
gatcacgcccgggtctaccaggacatgacgcagccattggctcactacttcatctcttca
tctcacaacacctacctcaccaaggaccagatgaccggggacagcagcactgagccatac
atacgagctctgagccatggctgtcgctgtgtagagctggactgctgggatggagatgga
ggggagcctgtcatctaccatggacacaccctgacctccaaagtgccctttgttgacgtc
atcaagatcatcaatgagtacgccttcaaggcgtcctcctttcctctgatcctctctctg
gagaaccactgctctgtggaacaacaagctgtcatggcccgacacctgcgctccattctt
ggggagaaactactgcagcggcctctcagcacagagaagtccaaatgccttccttcccca
gaggatctaaagggtaagatcctggtgaaggggaagagggaagagtcagcagaggagtgt
tcctccagttcttcagaccttaactcttcagatgacgagaccagcgtggcagaagggaga
tccaagaagaagaaagatggcaaaaaggctggtgtgtcaaagctgaatccagagctgtct
gagttggtggtatacacccgcagcgttcactttaagggttttgatcaagctgccaaaagc
tcgccactccaaatgtcgtccttctctgagagagaagcactcaagcttattaaggattct
ggggtcctctttgtgcgccacaatagtcacaagctcagcaggatttacccatctggccag
cgcctccagtcctccaactacaaccctcagcagatgtggaatgcaggctgtcagatcgtt
gctctgaacttccagacacctggcgagctgatggacctgaaccaaggccgttttctgcag
aacggtctgtgtggatatgttctgaagcctcctttcatgtgcacacctgacagcaccttc
aaccctgaaaacgttggaggaggccccggtcacagacctatcctcctcaccattcgggtc
atttcagctcagcagctcccaaaaccagaatgcgacaaacctagctctattgtggaccct
caagtttgggtggagattcatggagttcctattgacaacaacaaggagaaaactcattat
gttgagaacaatggctttaacccacagtggaactgcaccttgaatttcaccgtccatgtt
cccgacttggctctggtccgcttcatggtggaggatcacgactatacctcaagcaatgac
ttcctaggacaatacacgttacctttcaccagtatgcggtcaggttaccgacatgttccc
ttgtttaagcttgatgggtccagcctttcaccctctgcactcttcatccatgtgaagttc
agcacctgtcagagcagtccatccagatcctaa

DBGET integrated database retrieval system