KEGG   Oryzias latipes (Japanese medaka): 101173460Help
Entry
101173460         CDS       T02443                                 

Definition
protein-glutamine gamma-glutamyltransferase 2-like
Orthology
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101173460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 244 aa AA seqDB search
MTLGSDEEREAFTKANHQNKLLQQLQNDGLHLAIKVTSDMKKGCDFDVFAVVTNNTQSEK
MCRLVFGSCAESYNGTLGENCGFKDLLNVGLSPGAERRIPLRLNYSKYGSHLTEDNLIRL
AALVVDYSTKEAILAVRHIVLENPEIKVRILGEPKENRKLAAEITLQNPLPEPLENCCFS
IEGANLTGGHVLSERLSSTVGPGEDAKVKIYFTPSHSGLRKLVVDFDSNKLCHVKGYRNV
IIGK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttggatctgatgaggaacgggaagcttttacgaaggccaaccaccagaacaag
ctgctccagcagcttcagaatgatggcctccacctcgccatcaaagtgacatctgacatg
aagaagggctgtgactttgacgtgtttgctgtcgttactaacaacacacaaagtgagaag
atgtgtcgcctggtgtttggatcctgtgctgagtcctataatggcactctgggggagaac
tgtggatttaaggacctgctcaatgtgggcctctcaccaggtgcagaaagacgaattcca
ctgaggctgaactattccaagtacggcagccatctcacagaggacaacctgattcgtctg
gcagctctggtggtggactactccacaaaggaggccatactggcagtgagacatattgtg
ctggagaatccagaaatcaaagtcagaatcctgggagagccaaaggagaacaggaagctt
gctgcggagatcaccttgcagaacccgctaccagaaccgctggagaactgctgcttcagc
atcgagggagccaacctgaccggcggacacgtcctttctgaaaggctgagctccactgtg
ggacccggtgaagacgccaaagtgaaaatctacttcactcccagccactcggggctgagg
aagctcgtggtcgactttgacagtaacaaactgtgtcacgtcaaaggctacagaaacgtc
atcattggaaagtaa

DBGET integrated database retrieval system