KEGG   Oryzias latipes (Japanese medaka): 101173460Help
Entry
101173460         CDS       T02443                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2-like
  KO
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101173460
Cell adhesion molecules and their ligands [BR:ola04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     101173460
   VLA-5
     101173460
   VLA-9
     101173460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
5
AA seq 256 aa AA seqDB search
MGPHFVLDASASIIPGSDEEREAFTKANHQNKLLQQLQNDGLHLAIKVTSDMKKGCDFDV
FAVVTNNTQSEKMCRLVFGSCAESYNGTLGENCGFKDLLNVGLSPGAERRIPLRLNYSKY
GSHLTEDNLIRLAALVVDYSTKEAILAVRHIVLENPEIKVRILGEPKENRKLAAEITLQN
PLPEPLENCCFSIEGANLTGGHVLSERLSSTVGPGEDAKVKIYFTPSHSGLRKLVVDFDS
NKLCHVKGYRNVIIGK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgggaccacattttgtacttgatgcttctgcctctataattccaggatctgatgaggaa
cgggaagcttttacgaaggccaaccaccagaacaagctgctccagcagcttcagaatgat
ggcctccacctcgccatcaaagtgacatctgacatgaagaagggctgtgactttgacgtg
tttgctgtcgttactaacaacacacaaagtgagaagatgtgtcgcctggtgtttggatcc
tgtgctgagtcctataatggcactctgggggagaactgtggatttaaggacctgctcaat
gtgggcctctcaccaggtgcagaaagacgaattccactgaggctgaactattccaagtac
ggcagccatctcacagaggacaacctgattcgtctggcagctctggtggtggactactcc
acaaaggaggccatactggcagtgagacatattgtgctggagaatccagaaatcaaagtc
agaatcctgggagagccaaaggagaacaggaagcttgctgcggagatcaccttgcagaac
ccgctaccagaaccgctggagaactgctgcttcagcatcgagggagccaacctgaccggc
ggacacgtcctttctgaaaggctgagctccactgtgggacccggtgaagacgccaaagtg
aaaatctacttcactcccagccactcggggctgaggaagctcgtggtcgactttgacagt
aacaaactgtgtcacgtcaaaggctacagaaacgtcatcattggaaagtaa

DBGET integrated database retrieval system