KEGG   Oryzias latipes (Japanese medaka): 101173634Help
Entry
101173634         CDS       T02443                                 

Definition
prostaglandin G/H synthase 1-like
Orthology
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    101173634
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101173634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 576 aa AA seqDB search
MKVNPCCYYPCQNTGVCVRFGLEDYRCDCTRTGFYGDNCTTPELWTRIRLALKPRPSTVH
FLLTHFQWFWELINSSSLRDTIMKMVLTVRSDLIPSPPTYNTKYGYLSWEAYHNTSYYTR
LLPPVPADCPLPMGTKGKPVLPDVKLLTERFFRRQKFRPDPQGTNLMFAFMAQHFTHQFF
KTNRKAEGGFTNALGHGVDASNIYGEELARQHELRLHKDGKLKYQLLNGEMYPPTVSEVP
VHMVYPDSLPPEQRLAIGQEVFGLLPGLTMYATIWLREHNRICDILKAEHPTWDDEQLFQ
TTRLIIIGQIINIITEEYVQQLSGYHLKLKFEPSLLFNVRFQYSNRIALEFCHLYHWHPL
MPDSFVIDGDEIPLTSFIYNTSILMHYGVEKLVDAFSRQAAGQIGGGRNSHEAVLKVAQM
VITESRRTRMQPFNEYRKRFNLKPYASFQEFTDDKEMAEGLEELYGDVDALEFYPGVLLE
KARANSIFGESMVEMGAPFSLKGLMGNPICSPEYWKPSTFGGETGFNIVKTSTLKKLVCL
NTKWCPYVAFRVPPNQEVQTGSDSKKTRNKTRLEID
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaacccctgttgttactacccctgccagaacactggcgtgtgcgtgcggttc
ggcctggaagactacaggtgtgactgcacccgcacaggtttctatggagacaactgcacc
acccctgagttgtggaccaggattcgcctggcattgaagccccgcccctccacggtccac
ttcctgctgactcacttccagtggttctgggagctcatcaacagctcctccctcagagat
accatcatgaaaatggtgctgacagtcagaagtgatcttattccaagccccccgacctac
aacaccaagtacggatacctgagctgggaggcgtaccacaacacctcctactacacccgg
ctcctccctccagttcctgcagactgtcctttgccgatggggactaaagggaaaccagtc
ctgccagatgtgaaactgttgaccgaaaggtttttcaggaggcaaaagtttcgtcccgat
ccccaaggaaccaatctgatgtttgctttcatggctcagcatttcacccaccagttcttc
aagaccaaccgcaaagctgagggcggattcaccaatgctctgggacacggggtagatgca
agcaatatttatggagaagagctcgcaagacagcatgaacttcggcttcataaggatgga
aaactaaaataccagctgctgaacggggagatgtacccccccacagtttctgaggtcccc
gtgcacatggtgtatcccgacagtttaccccccgagcagcgcctggccatcgggcaggag
gtgttcggcctcctgcccggcctcaccatgtacgccaccatctggctgagggagcacaac
agaatctgcgacatcctgaaggccgaacatccaacctgggatgatgagcagcttttccag
accaccagactcatcatcatcggtcagatcatcaacataatcacagaagagtatgtgcag
cagctgagcggctaccatctgaagctgaagtttgagccctccctgcttttcaacgtgcgt
ttccagtacagcaaccgcatcgccctggagttctgtcacctctaccactggcaccctctg
atgccagacagcttcgtcatcgatggcgatgaaatcccgctaaccagcttcatatacaac
acctccatcctcatgcactacggtgtggagaaactggtggatgctttttctcgacaggca
gcaggacagatcggagggggtcgcaactctcatgaagcggttcttaaggtggcccagatg
gtgatcacagagtccaggaggacacgtatgcagcctttcaatgaatacaggaaaaggttc
aacttgaagccatacgcgtcctttcaggagttcactgacgacaaagaaatggctgaaggc
ttagaagaactgtacggtgacgtcgacgctctggagttttaccccggtgtcctgctggag
aaagcccgagccaacagcatctttggtgagagcatggtggagatgggcgcacccttctcc
ctgaaggggctgatgggaaatcccatctgctctccagagtactggaagcccagcaccttt
ggaggagagacgggcttcaatatcgtcaaaacgtccactctgaagaaactggtttgtctc
aacaccaagtggtgtccgtacgtggccttccgtgtcccaccaaaccaggaagttcaaaca
ggaagtgattccaagaagactagaaataagactagactagaaatagactag

DBGET integrated database retrieval system