KEGG   Oryzias latipes (Japanese medaka): 101173828Help
Entry
101173828         CDS       T02443                                 

Gene name
pik3cg
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Inositol phosphate metabolism
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101173828 (pik3cg)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    101173828 (pik3cg)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101173828 (pik3cg)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101173828 (pik3cg)
Membrane trafficking [BR:ola04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101173828 (pik3cg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
23
AA seq 1121 aa AA seqDB search
MDRQSIQVSDEEPEVPREECRRRRRKKAITSSSCVSMDQITIEFVMPSAARSGSGPDILT
LDVAGNWTVEQVKAQVWMKAVTLNLCPDFYQRLSPDHCILLYQKKGTVCEIYDKHQVFQT
LDCIPYWRALKKGVGRIQMVTRPQLSEESLQYQRYLNCLIGYDVTDVSNVHDDELEFTRR
KLLTPRRIELSDRDPKLYSMDPWVTRKPLPEHLLSKVNNSHILVVIHIGMVSQTIKVSIN
DTPSQVLASFFAKTANKRVLLGIPDDVCEADFVLRVCGREEFLYGEKPLQNFNWIRQCLK
NGEEIHLLLEKPPDPELDVVQKEDWAQVDDCTGVAGTHEQLTIDEKDHERVFTISMWDCN
RKFRVKVLGIDIPTLPKVPELVVFIEASIFHGQQLLAQERTTSKTFNEEVLWNCWLEFNI
KIKDLPKGARLNLQVICGKPTQTPASKGSSHYDNSAGTGSVEGKTKNRLLFYVNLLLVDH
RSLLRQGEFILHMWKMPEKSDESSSSINADKLTSATNPDKSSSMAVAILLDKYCYPVVLP
KSRDVGRDSGAGEEMEGGERGQREMPNHLKKQFEAIVSTDPLHPLSPEDKELLWHFRQEC
MRDPRAYPKLLGSVKWGKQEDVLATHRLLERSNAWDTSGLDVGLAMQLLDCHYSDSHVRS
MAVRKLETLEDDDVLRYLLQLVQAVKFEPYHDSALVRFLLKRALRSKRIGHFLFWFLRSE
IAQSMHYQQRYAVLLEAYLRGCGESMLQDFRKQVEMTMALQKVTRDIKAIAADKYDVSAQ
VVFQLRQKLETLQSSGLPETFRVPYDPGLRAGALLIEQCKVMASKKKPLWLQFKRADPTT
LSKDPIGIIFKDGDDLRQDMLILQILLIMESIWETECLDLCLLPYGCISTGNKIGMIEIV
KDATTIANIQQRVVGSTGAFKDEILHQWLRDKCVSEDKFQQAVERFLLSCGGYCVATYVL
GIGDRHNDNIMITESGNLFHIDFGHILGNYKSFMGISKEWVPFVLTPDFLYVMGTSGKKS
SPHFLKFQDVCVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIREALTVGRSEE
EAQRHLLDQIEICREKGWMVQVNWFVHLVLGIKQGVEKRST
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atggacaggcagtcgatccaggtgagcgacgaagagcctgaagtgccgcgagaagagtgc
aggaggaggaggagaaagaaagccatcacgtcgtcctcctgcgtctccatggaccagata
accattgagtttgtgatgccctctgcggcccgaagcgggagcggcccggacatcctaacg
ctggacgtggccgggaactggactgtggagcaggtgaaggctcaggtgtggatgaaggcg
gtgacgttaaacctttgccctgacttctaccagcgcttgtctcctgaccactgcatcctg
ctctatcagaagaaaggaaccgtgtgtgagatctacgacaagcaccaagtcttccagact
ctggactgcattccctactggagagcgctgaagaagggggtgggccggatccagatggtt
acccgcccgcagctgtctgaagagtccctgcagtaccagcgctacttgaactgcctgatc
ggctacgacgtgaccgatgtcagcaacgtccatgacgacgagctggagttcacacgccgg
aagctgctgacgcccagacgcatcgagctgtccgaccgggaccccaagctttactccatg
gacccctgggtcacccgcaagccgctgcccgagcatctgctctcaaaggtgaataatagt
cacatcctggtggttatccacattggtatggtcagccagaccatcaaggtctccatcaat
gacacaccttcacaggtgttggcgagctttttcgccaaaactgcaaataaaagggttctg
ctgggaatccctgacgacgtgtgtgaggcggattttgtgctgcgtgtgtgtggcagggaa
gagtttctgtacggagaaaagcctctccaaaacttcaactggattcgtcagtgtctcaaa
aatggggaggagatccacctgcttctagagaaaccacctgatccagaactggatgtggtc
caaaaggaggactgggctcaagtggacgattgtaccggagttgcaggaacccacgaacag
ttgaccatcgatgagaaagatcatgaacgggtgttcaccatctccatgtgggactgtaac
aggaagtttagggtaaaggtgttgggcatagacatccccaccctccccaaagtcccagag
ttggtggttttcatagaagccagcatttttcacggacagcagcttttagctcaggagcgg
acgacctccaagaccttcaatgaagaggtgctgtggaactgttggttggagttcaacatt
aaaatcaaggacttgcctaaaggggcgcgactgaacctgcaggtaatctgtgggaaacca
acccagacaccagcttccaaaggaagctcccactacgacaactcagcaggaactggcagc
gttgaaggaaaaaccaagaatcgtctcctgttctacgtcaacctgctgttggtggaccat
cgctctctactccggcaaggcgagttcatcctccacatgtggaagatgccggagaagagc
gacgagagcagcagcagcatcaacgctgacaagctcacctcggccaccaacccggacaag
tcctcctccatggccgtcgccattttgctggacaagtattgctaccctgtggtgttgccc
aagagcagggatgtgggtagagactctggggctggggaggagatggagggaggggagaga
ggtcagagagagatgccaaaccacctgaagaagcagtttgaggccatcgtgtcaacggac
cccttacaccccctcagtcctgaggacaaagagctgctctggcactttcggcaggagtgt
atgcgcgatccaagggcctacccaaagctgctgggctcagtcaagtgggggaaacaggaa
gatgttctggcgacgcatcgcctcttggagcgcagtaacgcctgggacacaagtggtctg
gatgttggtctggccatgcagctgctggactgccactactccgactcccacgttcgttcg
atggctgtcagaaagctggagaccctggaggacgatgacgtgctccggtatcttctccag
ctcgttcaggcggtcaagtttgagccctaccacgacagcgctctggtccggttcctgctg
aagagagctctgaggagtaagaggattggccatttcctcttctggttcttgcggagtgag
atcgctcagtccatgcactaccagcagaggtacgctgtgctgctggaggcctacttacgt
ggctgtggtgagagcatgctgcaggacttcaggaagcaggtggagatgaccatggctttg
cagaaagtcaccagggacatcaaggccatcgctgctgacaaatatgacgtctcggcgcag
gtggtgtttcagttacgtcagaagctggagactctgcagtcgtctggtctcccggagact
ttcagggtcccctacgacccggggctgagagctggagccctgctgatagagcagtgtaag
gtgatggcgtccaagaagaagcccctatggctgcagttcaaaagagccgaccccaccacc
ctgtccaaagaccccataggcatcatcttcaaggacggcgatgacctcagacaggatatg
ctcatcctgcagattctgctgatcatggagtcaatttgggagacggagtgtctggatctg
tgtctgctaccgtacggctgcatctccaccggcaacaagatcggtatgattgagatcgta
aaagacgccaccaccatcgccaacatccagcagagggtggtcggaagcacgggcgctttc
aaagatgaaattctgcaccagtggctccgggacaagtgcgtcagcgaggacaagttccag
caggctgtggagaggtttctgttgtcctgtggcggctactgtgtggccacgtacgtcctg
ggcatcggggatcgccataacgacaacatcatgatcacagaatcagggaacctctttcac
atcgacttcggtcacatcctggggaactacaagagcttcatgggaatcagtaaggagtgg
gttcccttcgtactcactccggacttcctgtacgtcatgggaacttcaggaaagaaaagc
agcccccacttcctgaagttccaggatgtgtgcgtgaaggcttacctggctcttcgtcat
cacaccaacctcctcatcatcttgttttccatgatgctgatgacaggtatgccccagctg
accagcaaagaggacatcgagtacatccgcgaggcgctcaccgtcggccgtagtgaggag
gaggcgcagcgccacctgctggaccagatagagatctgcagagaaaagggctggatggtt
caggtcaactggtttgttcacctagtgctggggatcaagcagggcgtggaaaaacgatcc
acttag

DBGET integrated database retrieval system