KEGG   Oryzias latipes (Japanese medaka): 101174785Help
Entry
101174785         CDS       T02443                                 

Definition
TGF-beta receptor type-2-like
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Adherens junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ola04010]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:ola04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:ola04068]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:ola04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ola04144]
Cellular Processes; Cell communication; Adherens junction [PATH:ola04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 564 aa AA seqDB search
MTRSGTAAFVAACSLLVVVEPFGSLRANVCKWCLPSTPVCKDNICLSNCNLSSYCSFTEE
ICIAIWRKTNETMTVHTMCHHPNLPLEGINPRLLLNFTSRECHMLPQPADEGVMMVCGCQ
GEQECNDKLIFDKGVSGFSRLHSKDVIPVVIVSLVPPLLVAMVATAVFYSYRMRRPDKPG
PASRSDWPTKRSPELYQVLDHPRGEAGGGVVVLGVEPVINNTKGRCPNKITVGKRIAELL
PIKLEDVVGRGRFAEVWRARLLQSDMGGVNSYETVAVKVFPNVEYASWRNECSILSDPTL
QHENLVQFLAAEERSLPSDTLRTYWIVLAHYSLGNMQDHLTANTLSWEELVSLASSIANG
LAHLHSETKLNGAPKVPVAHRDLKSSNILIKNRKQCVLCDFGLALRLDISLTVDDYANSG
QVGTARYMAPEVLESRVNLEDLEAFKQMDIYSMALVLWEMASRCDVIEEVKAYQPAFGSK
VCEQPCVDSMRDLVLRDRGRPDIPSAWTQHQGMSVFCSTITECWDHDPEARLTAHCVVER
FNAMQHSEEEAVLEDGGLGGGRQE
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggagcggaaccgcggctttcgtcgccgcttgcagtctcctggttgttgtcgag
cccttcggcagcctaagagccaacgtgtgtaaatggtgtttaccatccactccagtttgc
aaagacaacatctgcctcagcaactgtaacctgtcctcctactgttccttcacagaggag
atctgcatcgccatatggaggaagaccaatgaaacgatgacagtgcacacgatgtgtcac
catccgaatctgccgctggaaggcatcaaccctcgcctgttattgaattttacctccaga
gagtgtcacatgctcccacagccggcagatgagggtgtgatgatggtctgtggctgtcag
ggcgaacaggaatgcaacgacaaactcatctttgacaagggagtcagtggtttctccagg
ctgcacagtaaagatgtgatcccggtggtcatcgtcagcttggtgcctcctcttctggtt
gccatggtcgccactgctgtcttctactcctacagaatgcgccggcctgacaaaccaggg
cctgcttctcgatctgattggcccacaaagcgctcccctgaactctaccaagttttggat
catccacgtggagaagcaggaggtggtgtggtggttcttggagttgaaccagtgatcaat
aacaccaaaggcagatgtccaaataaaatcaccgtcggtaagaggatagctgagctgctc
cccatcaagctggaggacgtggtgggcagggggcgctttgctgaggtctggagggctcgc
ctgctgcagagcgacatgggtggagttaacagttacgaaactgtggcagtaaaggtgttt
cccaatgtggagtatgcctcatggagaaatgagtgctccatcctatctgaccctacactt
caacacgaaaacttggttcagttcctggcagctgaagaaagaagcctgccaagcgacact
ctcaggacttactggatagttttggcccattacagccttggaaatatgcaggaccacctc
acagcaaatactctaagctgggaggagcttgtttccttagcaagtagcatagctaacggg
ttagctcacttacacagtgaaacaaagctgaatggagcaccaaaggttcctgttgctcac
agagacctgaagagtagcaacattttgataaagaacaggaagcagtgtgtgctgtgtgac
tttggtctggcattaaggctggacatctccctcacagttgatgactacgccaacagcgga
caggtgggaacagctcgttacatggctcctgaggtgctggagtccagggtgaacctggag
gacctggaagctttcaaacagatggatatctactccatggctctggtcctttgggagatg
gcctcccgctgtgatgttattgaagaggtgaaggcctaccagccggcttttggctccaag
gtctgtgagcagccctgtgtggacagcatgagggacctggtgctgagggaccgaggacga
cctgacatcccctcagcatggacgcagcaccaggggatgagtgtcttctgctccaccatc
actgagtgctgggatcacgacccggaggcaaggctgacggcccactgcgtggtggagcga
ttcaacgccatgcagcacagtgaggaggaggcggtgctcgaggacggtgggctgggggga
ggacgacaagagtga

DBGET integrated database retrieval system