KEGG   Oryzias latipes (Japanese medaka): 101174945Help
Entry
101174945         CDS       T02443                                 

Definition
uncharacterized LOC101174945
Orthology
K14959  
histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ola00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 3692 aa AA seqDB search
MMAAAGCGSATAAAVGGQGGTATARGRFPGRPWSSRSRLRSEKRWQLGRSGFETDDVTNG
GPRPANLVLSLNEDQSHLRLLGIEASHKILGQAGYSSSESEEGEDFKGFEAEKKCSKKPV
IAQQNSSKGVGVKTKLKRPREKTPAVEAAIPPDLIKEENCLEEISSTPLEVAPAKNLKKG
SKGKSNSDRQSTKNRSSAAPRITIKLVAKKQIRAIKKPRKKSVKELKITEIHDEPNAQNT
QGEQILSDHVKLKPEPLEDKCSPLEKRAGNGPPRRRGRSAVKTAEPEGQTTAKVGVNDQK
SKEKELSDTVKDNGSAEPKLKASKKKKPGKLVTRRSNRVANPVSKKVLESPEDVGAQEKS
DQAEPKMEVSPTVETKPSKKRGGGQERKEGRRQSRRLNKDIPVPDCQGSSSAETNSLVVQ
PSEGLPFKNEKQRVPSLKLIKIKNPKYGAQASGKASSRKKKRRKYIWTLALVKVGGQGDG
NAVKTQPETIDREDPFVPCDTSVQKSCKDPGEKSKPENGTLKDSGDADASHLVPKKTLEK
SSLQADVPIDPSPETPQEVPKADCEKVPPLQIKKVSSPGKNKSSKPSFLIQQVSPVPDKK
EEVQQDPGDVPEDKTSCPDGEATPARRLRRRTSNLDSPQSKTVTKKQGGAQKRRLRAKPQ
GEDAPQVQAEVSSQVSTENLSPQVLPENPSPVLAGDAPQVSSVNSSEDLDRDISKYADPQ
SQLPGEVSPKKVENEAELQSKEAKPLPVPSKPRRCRNNKVGKKKSLQKKNAAVSPDTTVS
AAVGPVDSTNVDPVLKEDTPPAVEEVLQPEPKECLQPETQQVPLPLSVEEEPIQLPVKEE
PDLQLIDSQRSVMPESRAIAPEPSKKSLKKLKKRRINTVGPPQKHRHRGKDGKFAPLKSR
KNLSSCDVQVDGEISTSLAAAAPSPTSRLVGVHKKYKKGRAGLKYVEGKRPPQQTKIIST
LLEMGLDKGGLKQEEADTPVDGRQADGAAAHPGKSKFVKNIKHFIMPVVSARSSRVIKTP
QRFMDDAGMSVLPRRNSPKKGSQFVLQPRPGKKRDDDDVERAISPILPIDEEDILSEAQL
DVDLFTAQDFEDSLDIADSLFSERQCGTIENRSSFLKNSSFKWHMPEEAGEELYTLNKSP
ERKCEDLLLSTPVNKSIELSSGFLGDLKKKSLPKFNKQAAHLKIYQRLKKPHMGLPKSRM
TAEPDCLSKPLPPSIDLAEGLDDEAMSISLRQRDTVTETEKSKLKIEDLNTPGVIRKVCV
RATNSTSLVLHHSEEEEIERKEAVKIPTGELRARPNSGAAASTEKRARLTGANKRMFNLL
RKAKVQLFKIDQQKQLKSSGLLSATTGGRPQDLASKRQRRKQRVQPHPSVPVKTEPLQAQ
PPLISPLCQEFRRAGGPRIKHVCRAASVVLGQPRALVPDDIPRLSALPLHERSGISPSPI
AKDIGSPSESDSPELSDQKVTKSKKPTNFGKRKGLGPFGYRSRRCGVCKGCNHEEDCGKC
INCLDKPKFGGPNTKRQCCVYKRCDQIEERKARRLSGRTAPKGSSKRRRRSFSGGHSSNE
EGNDGAVDSPSADGQSPSVRKQPKRVVKPRVYFDLVDYDSDLDDKAFSSSASPARRRGAG
PRFSQDFVSLDGFLEDTSEDEFRHRKSSSHRVPQGRRKPEKGLPSPAALEQTPPSVLAAL
AHGFEQRHVESSKPTHKIRVDFKEDCTLENVWNMGGLSILSSAPVMPPYVCFLCASKGQH
EMLHCQVCCEPFHRFCLEPAERPSEENKENWCCRRCKFCHVCGKKNQLTKPLLECERCQN
CYHASCLGPNYPKLNKKRKAWVCMRCIRCKSCGVTPGKSWEIDWNHDKGLCPDCSKLYEQ
GNYCPICFKCYEDNDYDSQMMQCGTCNHWVHAKCEDLTDELYEILSSLPESVVYSCRPCS
VTQPSAWRELLYIELRAGVEKVLACLLSSTLTQHLVTCSQCEKLVDPDSGVEGRPACDLR
AVGKKFDKSLYTSLKMFHEDVVQVIRKRLEQEDDLPDERRPTALARSYYLKLLEEVFNWF
NSQDPKVWNPCTKDLPVGMLSSGVCPPTTEHVYAQWQEREEQSSRHPLGLLQEDNRQFLD
IKEEDGASPMLGDPASRNYFKSSRALKFKGKRGRLMKADFDTGWSKDDERQCSLCQKYGD
LKPDEAGRLLYLGQNEWAHVNCCLWSAEVFEEDNGSLLHVHSAVTRGRLMRCERCNKTGA
TVGCCLTSCQSNYHFMCARSRQCVFQDDKKVYCYKHRHLISGRMITGQEFEVNRRVYVDF
EGISLRRKFLTGLEPEFINVMIGSLQIDKLGVLSELSASKGKLFPVGFQCFRWYWSTVNP
LRRCRYTCTVREVRPVVPEKPIEEMPDQGDNLTIAHSPRQLPGATQTKPHHILTISDLEE
TRRARRHSPHSQSSGIRGHGPPTPLGPLPGPITLRAGKSSLPTSPLLPLGSSDSLINSPL
SRPAGGRTHCTSSFFPQSPWQDSTTSANLPFSTTMQHLPRNRFSFDLSQSDSVEVPHNFL
ASPEPEDVTPNPANGTSPHRELEKQRDKFSYDAFHKDSSISLNEEMRTELEIEETFLNEG
VAMNCGGQIVVEEDDQEEFWETAEEVPKTKTVANSLPLLAASAKEDLGNTSSEDDMEHYF
DFSRTIVSCQSSKDRSKSPSSSASRHLAQLDGIDDGTDSDASVATTDDAQKVFGPGKNPI
QSKNLNKNLPNIEITNSSLTPNTSLESRGMESSSATASTIGKVTHDCSHLHPLKPLDSSQ
SSDSPANQENLFSALDDDSFPNLLIKIPETTYSEKLLETPLLAECENAPHLTELLPVLQD
TPLQTQLETCKALDLEPDDGAFVSLAEGSAALVNHLTSNMVVPSLADSAVKSQDAVLGLL
ESSPLLSADAHISSESLVDSLQMDSSLPPLTSITLEPVTTPESMLPCTGPSAAKLTTLTS
VGEVRQTQIHISTQNDPVLGTTVPCPPAGSCQAVSVPLYSTQAQPFGSAAVTIVSSSASV
ASLSGLMTRCSAAAIPLQTTSTPVVLNGYSSTSLQKEATSGHMISINFSTPRPALEPQQP
VLPQALPGHAILTVKEVGGPNVDPTPHVLLVNRLGQIFVKNPESNTFQLPTPNSPSYNCV
NQIASLLQSNALSATLAAAGNVSSPTVGASIATAVPASLTPGVQNPATVTQLLAHNSNGA
VASVSVKKSKKTPKSSKDETVPELKKPKKKKESHSSKKPKTSKVAGQSSENTPVAPVESA
QAIINQAMASNYTPKWGGLRTMSPSSLVLPPGLLLEPEPPASPPSPAPAPPPASRPRTHV
RMKRVSSLSDRIVIKKSKVDFLQPEPSSEDEKPPKITFPSISSRASGVRIKTPTVKGVLN
LDELTEEHLSDSESSGSEPWGYLSQGEQDKPFAWETAGHSILTDWKKYSVAWKAVIDGVQ
EARAIAKLRPLTFQRVTGAGMLGLVHDTVVFLLEQLEGAHRCQKHTFRFFKQQSPDDDLP
VNPNGCARSELYLRKSTFDMFNFLASQHRQLPDIGPYDDEEDEVLLKSTRRATSLELPMA
MRFRHLERTSKEAVGVYRSAIHGRGLFCKRNIEAGEMVIEYAGIVIRSVLTDKREKYYDG
KGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVINVEGRKHIVIFALRKIYRG
EELTYDYKFPIEDASNKLNCNCGARRCRRFLN
NT seq 11079 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggcagcgggatgcggatcagcaaccgcggctgccgtaggaggccaaggtgga
actgctacggccagaggtcgtttccctggtcggccatggtcttcgcgtagtcgtttgcgt
tccgagaagcgatggcaactcggaagatcaggctttgaaactgacgatgtgactaacgga
gggccaaggcccgcaaacctggttctgtcgttaaacgaagaccagtctcacttgcgctta
ctggggatagaggcaagtcacaagatccttggccaggctggatacagctctagtgagagt
gaagagggggaagacttcaaaggatttgaagctgagaagaaatgctccaaaaaacctgta
atagctcaacaaaattcttccaaaggggttggtgtcaaaaccaaattgaagcgaccgcgg
gaaaagacgccagcggtggaggcagccattcccccagacctcataaaagaagaaaactgt
ttggaagaaatatctagcacacctctcgaagtggcaccagcaaagaatttgaagaagggt
tcaaaaggaaaaagcaattcagatcgtcagtccactaagaacagatcttcagcagcacca
aggataaccataaagttagtggccaaaaagcaaatcagagccataaagaagcctcggaaa
aaatctgtgaaggagttgaagattacggagattcatgatgagcctaatgcccagaacact
cagggtgagcagattttaagtgatcatgttaagttaaaacccgaaccactggaggacaag
tgcagcccgctggagaaaagagctggaaatggacctccaagaaggcgagggagatctgcc
gtcaagacagcagaacccgaaggccagactactgccaaagttggggttaatgaccaaaaa
tcgaaagagaaagaactgtctgacactgtaaaggacaatgggtctgctgagccaaaactg
aaggcatcaaagaaaaagaaaccaggcaaacttgtcacacgcaggagtaatagagtcgct
aacccagtctctaaaaaagtcctggagagtccggaggacgttggagctcaggagaaaagt
gatcaagctgagcccaagatggaagtttcaccaacggtggagactaaaccatcaaaaaaa
agaggaggaggacaggagcggaaggaaggccggaggcaaagcagaagactaaataaggat
attccggtaccagattgccagggctcgtcctcagcagagacaaatagtttagttgtccag
ccaagtgagggtttgccttttaaaaatgagaagcaaagggttccaagcttaaagctgata
aagatcaaaaaccccaagtatggcgcacaggccagtgggaaggcttcatcgcggaagaaa
aaacggagaaaatacatctggacgttagcattagtgaaggtcgggggtcaaggtgatgga
aatgctgtcaaaacacagccggagaccatcgacagggaggatccgtttgttccttgtgat
accagcgtccagaaaagctgtaaggatccaggtgagaaatccaaaccggaaaatggaacc
ttaaaagacagcggtgacgctgatgctagtcatttagttccgaaaaagactttagaaaag
tctagtttacaagcggacgttcccatagatccctcacccgaaacacctcaagaagtccct
aaagctgactgcgagaaagtgccgccccttcagattaaaaaggtctcatctcctggcaag
aacaagagttccaagccctcctttttgatccaacaggttagccccgtacctgacaagaaa
gaggaggttcagcaagatccaggtgacgttccggaggataaaacatcctgtccggatggt
gaagctacacctgctaggagactaagaagaagaacgtctaacctcgattctccacagagt
aagaccgtcactaagaagcaaggtggtgctcagaaaaggaggcttagagcaaaacctcaa
ggtgaagatgctccacaggtgcaagctgaagtttcttctcaggtttccactgaaaatctc
agcccacaagttcttcccgaaaacccaagtcctgttttggctggagacgcgccgcaggtg
tccagtgtgaactcctccgaagaccttgacagggacatctcaaaatatgctgacccccaa
tcccagttgccaggtgaagtttcccctaagaaggtggagaatgaggcggagcttcagagt
aaagaggccaaacccttgcctgtgccttccaaaccaaggagatgtagaaacaataaagtt
gggaaaaagaagtcactccagaagaaaaatgcagcggtttctcccgataccacagtcagc
gcagctgtcggcccggttgattccacgaatgtagatccggttttaaaggaagacactccg
cctgcagtcgaagaagtgcttcagccagaaccaaaagagtgcctccagccagaaacccag
caggtccctctgcctctgtcggtggaggaggagcccatacagctgccggtgaaagaggaa
ccggacctgcagttgatcgatagccagaggtccgtgatgccagagagtcgagcgattgct
ccagaaccatcaaaaaagagcctcaaaaagctgaaaaagcggcgcatcaacacagtggga
ccgccgcagaaacacaggcacagagggaaggatggaaagttcgctcctttaaaatcccgc
aaaaacctgagcagttgtgatgtccaggtagacggagagatttccacctcacttgcagct
gctgctccttccccaacctccaggctcgtgggagtgcataaaaagtacaaaaaggggcga
gcaggcctcaaatacgttgaaggcaaaaggccaccgcagcaaactaaaatcatttctact
ctccttgaaatggggctggacaaaggcggtctgaaacaggaggaagctgacacgccggtg
gacgggaggcaagcagacggcgccgcggcccatccgggtaaatccaagtttgtcaaaaac
atcaagcacttcatcatgccggtcgtgagtgcccgatcctcgcgagtgatcaagaccccc
cagaggtttatggacgatgctgggatgtctgttctgccacgaagaaactccccaaagaaa
ggttcccagtttgtcttgcagccgcgtccggggaagaagagagatgatgatgatgtggag
agagcgatatcccccatacttccaatcgatgaggaggacatattgagtgaagctcagctg
gatgtcgatctgttcactgctcaggattttgaagacagccttgacatagctgattcgttg
ttttctgaaagacagtgcggcacgatagaaaacaggagttcctttctgaagaactccagc
ttcaagtggcacatgcctgaggaggcgggtgaggaattgtatacactgaataaaagtcca
gagaggaaatgcgaggatctcttactctccactccggttaacaagtcaatcgagctgtca
tctggcttcctgggagatctgaaaaagaaaagtttgcctaagtttaacaagcaggccgct
cacctgaagatctatcagaggctgaagaaaccccacatgggacttcctaagagcaggatg
accgctgagccagactgtttgagcaaaccccttccaccttcaatagacttagccgaagga
ctggacgacgaggccatgagcatcagtctaaggcaacgagatacagtcacagagacggag
aagtccaagctaaagatcgaggacctcaacactcctggggtcattaggaaggtttgtgtt
cgggctaccaactccacatcgctggtgttgcaccacagcgaagaggaggaaatagaaagg
aaagaagctgtaaagattcccactggagagctgcgggcgaggccaaactcgggcgcggct
gcatctacggagaagcgtgcacgcctcactggtgcaaataaaagaatgttcaatctcctc
aggaaagccaaggttcaactctttaaaattgaccagcagaagcagctgaaatcttcaggg
ctgttgtccgccacaaccggaggcagacctcaagatttagcatccaagagacagagaagg
aagcagagggtgcagcctcatccgagtgttccagtcaagactgagccccttcaagcacaa
cccccgctcatctccccgctgtgccaggagttcagaagagcaggaggtcctcggatcaag
cacgtgtgtcgagctgcctctgtggtgctcgggcagcctcgagcgctcgtgccggatgac
attcccagactaagcgccttgccactgcatgaaagatctggtatttctccatcacccatc
gctaaagatattggatctccatctgagtccgacagccccgaattgtctgatcaaaaagta
accaagtcgaaaaagccaacaaactttggaaaaaggaaagggctgggaccgtttgggtac
cgctcccggaggtgtggggtgtgcaaaggctgcaaccacgaggaggactgcggcaaatgc
ataaactgcctcgacaaacccaagtttggagggcccaacacaaagcggcagtgttgtgtc
tataagagatgtgatcagatcgaagaaagaaaggcacgcagactgagtggaagaacggca
cccaaaggttcctcaaagcgccgccggcggtcgttcagtgggggtcattccagtaacgag
gaaggcaacgacggcgctgtggactctccatcggctgacgggcagagtccgtctgtaagg
aagcagccgaagcgcgtcgtcaaacctcgtgtctactttgacctggtggattatgactcc
gatctggatgataaggccttctccagctctgcctcaccagcgaggagaaggggtgctgga
cctcgcttcagtcaagactttgtttctcttgatgggttcttggaagacacctcagaggat
gaattcagacatcgaaaatccagctcccatcgtgtgccacagggtcgacgtaaacctgag
aagggtctcccatctccggctgcgttggaacagactcctccgagtgtcctcgcagctctg
gcccacggattcgaacaacgacacgtcgagtcttctaaacctactcacaaaatccgggtc
gacttcaaggaggactgcaccttagagaacgtttggaatatggggggtttgagtatactg
agttctgcccctgtcatgccaccttacgtttgcttcctgtgtgccagtaaggggcaacat
gagatgttgcactgccaagtgtgctgtgagcccttccaccggttttgccttgaaccagca
gagcgcccctctgaggagaacaaagaaaattggtgctgcagacgctgcaagttctgtcat
gtgtgcggcaagaagaaccagctgactaagcctttattagaatgtgagcggtgccagaac
tgttatcacgcttcctgtttgggacccaactatcccaaactaaacaagaaaaggaaagcc
tgggtttgtatgcgatgcatcaggtgcaaaagctgcggtgtcacgccgggcaagagttgg
gagattgactggaaccacgacaaaggcctttgtccagactgttcaaaactttacgagcag
gggaactactgtccaatctgcttcaagtgttacgaagacaatgactacgacagtcagatg
atgcagtgcggcacatgtaatcactgggtacacgccaagtgtgaggatctgacagacgag
ctgtatgaaatcctgtccagtttaccagaaagtgtggtgtactcgtgtcggccgtgcagc
gtcacccagcccagtgcctggagggagcttctttacattgaactcagggcaggggtggag
aaagtcctggcatgcttactctcctccaccctcacccagcaccttgtcacatgctcacag
tgtgaaaagctggttgatcctgacagtggggttgaaggcaggccggcctgtgacctccga
gctgttggcaagaagtttgataaaagcctttatacatcactgaaaatgtttcacgaagat
gtggttcaggtgatacgaaagaggctcgaacaagaagacgaccttcctgacgagcggagg
cccactgccctggcacgctcctactacttaaagctccttgaagaggttttcaactggttc
aacagccaagacccaaaggtgtggaacccttgtaccaaagacttgcccgtggggatgctg
tccagtggtgtctgtccccccacaacagaacatgtgtacgcgcagtggcaggagcgggag
gagcagtcgtcccggcatccactgggtcttctgcaggaggacaaccggcagtttttggac
attaaggaagaggatggggcgtctccgatgttgggtgatccagcgagccggaactatttc
aaaagcagcagggctctcaaatttaaaggaaaaagagggaggcttatgaaggctgacttt
gacactggttggtctaaagacgatgagaggcagtgttctttgtgtcagaaatatggcgat
ctcaaacctgatgaagcaggaaggttgctgtatctgggccagaacgagtgggcccacgtc
aactgttgtctgtggtctgcagaggtgtttgaagaggacaacggctctctgctgcatgta
cacagcgctgtcacaagggggcgcttgatgaggtgtgagcgctgcaataagacgggcgcc
accgtaggctgctgcctgacatcctgtcagagcaactaccacttcatgtgtgcgcgttcc
aggcagtgtgtcttccaggatgataagaaggtgtactgctacaaacacaggcatctcatc
agtggcaggatgatcaccggccaagaatttgaagtcaaccgcagagtgtatgtagatttt
gagggaatcagcctccgcagaaagttcttgactggattggaaccagaatttatcaatgtg
atgattggctctttgcagatcgacaaactaggtgtcctgagtgaactttcagcgagcaaa
ggcaaattgtttcctgttgggtttcaatgctttcggtggtactggagtacagttaaccct
ctccgccggtgcagatacacatgtacagtccgtgaggtgcgcccagttgtcccagagaaa
cctattgaagaaatgcctgaccaaggagacaatctcaccattgctcacagcccccgtcaa
cttcctggtgcaacccagacaaaaccccaccatatcctgaccataagtgatctagaagag
actcgaagagctcgtcgccacagcccacactcacaatcctctggcatacgtggtcatggt
cctccaactcccttaggtcctttacctggtccaattacgctccgtgccggcaaatcttca
ctgcccacctcccctttattgccactcggttcttctgatagtctgatcaactctccctta
tcccgccccgctggaggtagaacacactgtacatcgtcgttctttcctcagtctccttgg
caggacagtaccacctcagcaaacctgcctttctctacaaccatgcagcatttaccccgg
aatcgattttcatttgatctcagccaatcagattctgttgaagtgccgcacaacttttta
gcttcccctgaacccgaagacgttacaccaaatcctgcaaatggtacatcccctcacaga
gagttggaaaaacaaagagacaagttttcttatgacgcctttcacaaagactcgagcata
agtctgaacgaagagatgaggaccgaactagagattgaagaaacattcctgaatgaaggg
gttgcgatgaactgtggggggcaaatagtggtggaagaagacgatcaggaggagttctgg
gaaacggcagaagaggtcccgaagaccaaaaccgttgctaacagtcttccgctgcttgca
gcctcagccaaggaagacttggggaacacatcctctgaagatgacatggagcactatttt
gatttttcacgaactatagtcagctgccaatcatcaaaagatcgctccaagtctccctcc
tcttctgcatctcgacatttggctcagctggatgggatcgatgatggcacagacagtgac
gcaagtgttgcaaccacagatgatgctcagaaggtgttcgggcccgggaaaaatccgata
caaagcaaaaatctgaacaaaaatctcccaaacattgaaattacaaacagttcactgacc
ccgaacacatcactggaaagcaggggaatggagtcttcttctgcgacagcctcaactatc
ggaaaggttacgcatgactgttcacacctacatccgttgaaaccacttgattccagtcag
agctcagactctccagcaaatcaggaaaacttattttctgctctcgacgacgactctttc
cctaacttgctcatcaaaattccagagacgacatattcagagaaattgttggaaactccc
cttttagctgaatgcgaaaatgccccccatcttactgagctgcttcctgttctacaagac
acacctctccagacccagcttgaaacctgtaaagccctggacctagagcctgacgatggc
gcctttgtttcgttggcagaggggtccgccgcgttggtgaatcacttaacatctaacatg
gtagtgccttcattagcagattctgcagtcaaaagccaggacgccgtgctgggtctgctt
gagtcatcccctctactgtctgcagatgcacacatctcttcagaaagccttgtggactcc
ctccagatggattcttctttaccccctctcacaagcatcactcttgaaccagtgaccact
ccggagtcaatgttgccgtgcacaggaccttcagctgctaaactaacaacgctcacttct
gtaggagaagttagacaaacacagatacatatttccactcaaaatgatccagtgctagga
acgactgtcccttgccccccagcaggatcttgccaagcggtttccgtgcctttgtactcc
acacaagcgcagccattcggttcagcggctgtcaccatcgtttcctcctctgcctcggta
gcttcactttccggactgatgacgcgctgttcggctgctgcgataccgctgcaaaccacc
tccaccccagtggtcctaaacggttacagctccacatctttgcagaaggaagccacatct
gggcacatgatttctatcaacttctccacccccaggccagctctagaacctcagcagcca
gtgcttccccaagcattacctggacatgccatcctcactgtgaaagaggtgggaggtcct
aatgtagatccgacaccacatgttctactggttaaccggctcgggcaaatctttgtgaaa
aacccagaaagtaacaccttccagcttcccactcccaactccccttcttataactgtgtc
aaccagattgccagccttttgcagagcaatgccctttcagccacactggcagcagccggc
aacgtttcttctccgacagttggagccagcatagcgacggctgtccccgcatcactcaca
cccggggtgcagaatccagcaacggttacacagctgctcgcccacaatagcaacggtgca
gtggcatcagtgagtgtgaaaaagtccaagaaaaccccaaaatcttcaaaggatgaaaca
gtgccagagttgaaaaaaccaaaaaagaagaaagagagtcactcttctaaaaaaccaaaa
acatcaaaggttgcagggcagtcatctgaaaacacacctgtagcccctgttgaaagtgcc
caagcaattatcaatcaagcaatggcgagtaactacacccccaagtggggtgggctacga
acgatgagcccctcttcgctggttctcccaccgggtcttctacttgaaccagaacctcca
gcatcacccccctccccagccccggcgccaccacctgcatctcggcctcgcacccatgtc
cggatgaaaagggtgtcttcgctttcggaccgtattgtcataaaaaagtccaaagtggac
ttcctgcaaccagaacccagcagcgaagatgagaagcctccgaaaatcacctttcccagc
atctccagtcgggcctcaggagtgcggatcaagaccccgactgtgaaaggagtcctaaac
ctggatgagctgacagaggagcacttaagtgattctgagagctcaggctcagagccgtgg
ggttatttgtctcagggtgaacaagacaaaccatttgcatgggaaactgcgggacacagc
attctgaccgactggaaaaaatactctgtggcttggaaagcagtgatcgatggtgtgcag
gaagctcgcgctatagcaaagctgaggcccctgaccttccagagagtcacaggggccggc
atgctgggattggtacacgacacagtggttttcctgttggaacaacttgaaggagctcac
cgttgccagaagcacactttccgtttcttcaaacagcagagcccagatgatgatcttcct
gttaaccctaatggctgtgctcggtctgagctgtatctcaggaagtctacgtttgatatg
ttcaactttttagcttctcagcatagacagcttcctgacatagggccttatgatgacgaa
gaagatgaggttcttttgaagtctactagacgagccactagtttggagttacccatggcc
atgcgcttcagacacctggagagaacatccaaagaggccgtgggagtctacaggtctgcc
atccatggccgtggcctcttctgcaagaggaacattgaagcaggcgagatggtcatcgag
tatgcaggcattgtgatccgctcagtgctcactgacaaaagagaaaagtactacgacggc
aagggcatcggctgctacatgttccggatagacgactttgacgtggtggacgcaactatg
catggcaacgcagcgcggttcatcaaccactcttgtgagcccaactgctactcaagggtg
atcaacgtggagggacgcaagcatatcgtcatctttgctctaagaaaaatctaccggggg
gaggagctcacttatgactacaagttccccattgaagacgccagcaacaaactgaactgc
aactgtggtgcccggcgatgccgccgattcctcaactga

DBGET integrated database retrieval system