KEGG   Oryzias latipes (Japanese medaka): 101174945Help
Entry
101174945         CDS       T02443                                 

Gene name
kmt2b
Definition
(RefSeq) histone-lysine N-methyltransferase 2B
  KO
K14959  
histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101174945 (kmt2b)
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101174945 (kmt2b)
Transcription factors [BR:ola03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    101174945 (kmt2b)
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101174945 (kmt2b)
   HMT complexes
    MLL3/MLL4 complex
     101174945 (kmt2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
16
AA seq 3784 aa AA seqDB search
MCVCVVVEAMMAAAGCGSATAAAVGGQGGTATARGRFPGRPWSSRSRLRSEKRWQLGRSG
FETDDVTNGGPRPANLVLSLNEDQSHLRLLGIEASHKILGQAGYSSSESEEVRSQIDPGG
EDFKGFEAEKKCSKKPVIAQQNSSKGVGVKTKLKRPREKTPAVEAAIPPDLIKEENCLEE
ISSTPLEVAPAKNLKKGSKGKSNSDRQSTKNRSSAAPRITIKLVAKKQIRAIKKPRKKSV
KELKITEIHDEPNAQNTQGEQILSDHVKLKPEPLEDKCSPLEKRAGNGPPRRRGRSAVKT
AEPEGQTTAKVGVNDQKSKEKELSDTVKDNGSAEPKLKASKKKKPGKLVTRRSNRVANPV
SKKVLESPEDVGAQEKSDQAEPKMEVSPTVETKPSKKRGGGQERKEGRRQSRRLNKDIPV
PDCQGSSSAETNSLVVQPSEGLPFKNEKQRVPSLKLIKIKNPKYGAQASGKASSRKKKRR
KYIWTLALVKVGGQGDGNAVKTQPETIDREDPFVPCDTSVQKSCKDPGEKSKPENGTLKD
SGDADASHLVPKKTLEKSSLQADVPIDPSPETPQEVPKADCEKVPPLQIKKVSSPGKNKS
SKPSFLIQQVSPVPDKKEEVQQDPGDVPEDKTSCPDGEATPARRLRRRTSNLDSPQSKTV
TKKQGGAQKRRLRAKPQGEDAPQVQAEVSSQVSTENLSPQVLPENPSPVLAGDAPQVSSV
NSSEDLDRDISKYADPQSQLPGEVSPKKVENEAELQSKEAKPLPVPSKPRRCRNNKVGKK
KSLQKKNAAVSPDTTVSAAVGPVDSTNVDPVLKEDTPPAVEEVLQPEPKECLQPETQQVP
LPLSVEEEPIQLPVKEEPDLQLIDSQRSVMPESRAIAPEPSKKSLKKLKKRRINTVGPPQ
KHRHRGKDGKFAPLKSRKNLSSCDVQVDGEISTSLAAAAPSPTSRLVGVHKKYKKGRAGL
KYVEGKRPPQQTKIISTLLEMGLDKGGLKQEEADTPVDGRQADGAAAHPGKSKFVKNIKH
FIMPVVSARSSRVIKTPQRFMDDAGMSVLPRRNSPKKGSQFVLQPRPGKKRDDDDVERAI
SPILPIDEEDILSEAQLDVDLFTAQDFEDSLDIADSLFSERQCGTIENRSSFLKNSSFKW
HMPEEAGEELYTLNKSPERKCEDLLLSTPVNKSIELSSGFLGDLKKKSLPKFNKQAAHLK
IYQRLKKPHMGLPKSRMTAEPDCLSKPLPPSIDLAEGLDDEAMSISLRQRDTVTETEKSK
LKIEDLNTPGVIRKVCVRATNSTSLVLHHSEEEEIERKEAVKIPTGELRARPNSGAAAST
EKRARLTGANKRMFNLLRKAKVQLFKIDQQKQLKSSGLLSATTGGRPQDLASKRQRRKQR
VQPHPSVPVKTEPLQAQPPLISPLCQEFRRAGGPRIKHVCRAASVVLGQPRALVPDDIPR
LSALPLHERSGISPSPIAKDIGSPSESDSPELSDQKVTKSKKPTNFGKRKGLGPFGYRSR
RCGVCKGCNHEEDCGKCINCLDKPKFGGPNTKRQCCVYKRCDQIEERKARRLSGRTAPKG
SSKRRRRSFSGGHSSNEEGNDGAVDSPSADGQSPSVRKQPKRVVKPRVYFDLVDYDSDLD
DKAFSSSASPARRRGAGPRFSQDFVSLDGFLEDTSEDEFRHRKSSSHRVPQGRRKPEKGL
PSPAALEQTPPSVLAALAHGFEQRHVESSKPTHKIRVDFKEDCTLENVWNMGGLSILSSA
PVMPPYVCFLCASKGQHEMLHCQVCCEPFHRFCLEPAERPSEENKENWCCRRCKFCHVCG
KKNQLTKPLLECERCQNCYHASCLGPNYPKLNKKRKAWVCMRCIRCKSCGVTPGKSWEID
WNHDKGLCPDCSKLYEQGNYCPICFKCYEDNDYDSQMMQCGTCNHWVHAKCEDLTDELYE
ILSSLPESVVYSCRPCSVTQPSAWRELLYIELRAGVEKVLACLLSSTLTQHLVTCSQCEK
LVDPDSGVEGRPACDLRAVGKKFDKSLYTSLKMFHEDVVQVIRKRLEQEDDLPDERRPTA
LARSYYLKLLEEVFNWFNSQDPKVWNPCTKDLPVGMLSSGVCPPTTEHVYAQWQEREEQS
SRHPLGLLQEDNRQFLDIKEEDGASPMLGDPASRNYFKSSRALKFKGKRGRLMKADFDTG
WSKDDERQCSLCQKYGDLKPDEAGRLLYLGQNEWAHVNCCLWSAEVFEEDNGSLLHVHSA
VTRGRLMRCERCNKTGATVGCCLTSCQSNYHFMCARSRQCVFQDDKKVYCYKHRHLISGR
MITGQEFEVNRRVYVDFEGISLRRKFLTGLEPEFINVMIGSLQIDKLGVLSELSASKGKL
FPVGFQCFRWYWSTVNPLRRCRYTCTVREVRPVVPEKPIEEMPDQGDNLTIAHSPRQLPE
SQAQERVSTEPHLSSEEASVQGHFIKSDHSTRPKIPRRPAGGLSRPLPSPGATQTKPHHI
LTISDLEETRRARRHSPHSQSSGIRGHGPPTPLGPLPGPITLRAGKSSLPTSPLLPLGSS
DSLINSPLSRPAGGRTHCTSSFFPQSPWQDSTTSANLPFSTTMQHLPRNRFSFDLSQSDS
VEVPHNFLASPEPEDVTPNPANGTSPHRELEKQRDKFSYDAFHKDSSISLNEEMRTELEI
EETFLNEGVAMNCGGQIVVEEDDQEEFWETAEEVPKTKTVANSLPLLAASAKEDLGNTSS
EDDMEHYFDFSRTIVSCQSSKDRSKSPSSSASRHLAQLDGIDDGTDSDASVATTDDAQKV
FGPGKNPIQSKNLNKNLPNIEITNSSLTPNTSLESRGMESSSATASTIGKVTHDCSHLHP
LKPLDSSQSSDSPANQENLFSALDDDSFPNLLIKIPETTYSEKLLETPLLAECENAPHLT
ELLPVLQDTPLQTQLETCKALDLEPDDGAFVSLAEGSAALVNHLTSNMVVPSLADSAVKS
QDAVLGLLESSPLLSADAHISSESLVDSLQMDSSLPPLTSITLEPVTTPESMLPCTGPSA
AKLTTLTSVGEVRQTQIHISTQNDPVLGTTVPCPPAGSCQAVSVPLYSTQAQPFGSAAVT
IVSSSASVASLSGLMTRCSAAAIPLQTTSTPVVLNGYSSTSLQKEATSGHMISINFSTPR
PALEPQQPVLPQALPGHAILTVKEVGGPNVDPTPHVLLVNRLGQIFVKNPESNTFQLPTP
NSPSYNCVNQIASLLQSNALSATLAAAGNVSSPTVGASIATAVPASLTPGVQNPATVTQL
LAHNSNGAVASVSVKKSKKTPKSSKDETVPELKKPKKKKESHSSKKPKTSKVAGQSSENT
PVAPVESAQAIINQAMASNYTPKWGGLRTMSPSSLVLPPGLLLEPEPPASPPSPAPAPPP
ASRPRTHVRMKRVSSLSDRIVIKKSKVDFLQPEPSSEDEKPPKITFPSISSRASGVRIKT
PTVKGVLNLDELTEEHLSDSESSGSEPWGYLSQGEQDKPFAWETAGHSILTDWKKYSGIL
VLINAIMQRFVFAYLLVICPLVAWKAVIDGVQEARAIAKLRPLTFQRVTGAGMLGLVHDT
VVFLLEQLEGAHRCQKHTFRFFKQQSPDDDLPVNPNGCARSELYLRKSTFDMFNFLASQH
RQLPDIGPYDDEEDEVLLKSTRRATSLELPMAMRFRHLERTSKEAVGVYRSAIHGRGLFC
KRNIEAGEMVIEYAGIVIRSVLTDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAARFI
NHSCEPNCYSRVINVEGRKHIVIFALRKIYRGEELTYDYKFPIEDASNKLNCNCGARRCR
RFLN
NT seq 11355 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtatgtgttgttgttgaagcaatgatggcggcagcgggatgcggatcagcaacc
gcggctgccgtaggaggccaaggtggaactgctacggccagaggtcgtttccctggtcgg
ccatggtcttcgcgtagtcgtttgcgttccgagaagcgatggcaactcggaagatcaggc
tttgaaactgacgatgtgactaacggagggccaaggcccgcaaacctggttctgtcgtta
aacgaagaccagtctcacttgcgcttactggggatagaggcaagtcacaagatccttggc
caggctggatacagctctagtgagagtgaagaggtgaggtcccaaatcgacccaggaggg
gaagacttcaaaggatttgaagctgagaagaaatgctccaaaaaacctgtaatagctcaa
caaaattcttccaaaggggttggtgtcaaaaccaaattgaagcgaccgcgggaaaagacg
ccagcggtggaggcagccattcccccagacctcataaaagaagaaaactgtttggaagaa
atatctagcacacctctcgaagtggcaccagcaaagaatttgaagaagggttcaaaagga
aaaagcaattcagatcgtcagtccactaagaacagatcttcagcagcaccaaggataacc
ataaagttagtggccaaaaagcaaatcagagccataaagaagcctcggaaaaaatctgtg
aaggagttgaagattacggagattcatgatgagcctaatgcccagaacactcagggtgag
cagattttaagtgatcatgttaagttaaaacccgaaccactggaggacaagtgcagcccg
ctggagaaaagagctggaaatggacctccaagaaggcgagggagatctgccgtcaagaca
gcagaacccgaaggccagactactgccaaagttggggttaatgaccaaaaatcgaaagag
aaagaactgtctgacactgtaaaggacaatgggtctgctgagccaaaactgaaggcatca
aagaaaaagaaaccaggcaaacttgtcacacgcaggagtaatagagtcgctaacccagtc
tctaaaaaagtcctggagagtccggaggacgttggagctcaggagaaaagtgatcaagct
gagcccaagatggaagtttcaccaacggtggagactaaaccatcaaaaaaaagaggagga
ggacaggagcggaaggaaggccggaggcaaagcagaagactaaataaggatattccggta
ccagattgccagggctcgtcctcagcagagacaaatagtttagttgtccagccaagtgag
ggtttgccttttaaaaatgagaagcaaagggttccaagcttaaagctgataaagatcaaa
aaccccaagtatggcgcacaggccagtgggaaggcttcatcgcggaagaaaaaacggaga
aaatacatctggacgttagcattagtgaaggtcgggggtcaaggtgatggaaatgctgtc
aaaacacagccggagaccatcgacagggaggatccgtttgttccttgtgataccagcgtc
cagaaaagctgtaaggatccaggtgagaaatccaaaccggaaaatggaaccttaaaagac
agcggtgacgctgatgctagtcatttagttccgaaaaagactttagaaaagtctagttta
caagcggacgttcccatagatccctcacccgaaacacctcaagaagtccctaaagctgac
tgcgagaaagtgccgccccttcagattaaaaaggtctcatctcctggcaagaacaagagt
tccaagccctcctttttgatccaacaggttagccccgtacctgacaagaaagaggaggtt
cagcaagatccaggtgacgttccggaggataaaacatcctgtccggatggtgaagctaca
cctgctaggagactaagaagaagaacgtctaacctcgattctccacagagtaagaccgtc
actaagaagcaaggtggtgctcagaaaaggaggcttagagcaaaacctcaaggtgaagat
gctccacaggtgcaagctgaagtttcttctcaggtttccactgaaaatctcagcccacaa
gttcttcccgaaaacccaagtcctgttttggctggagacgcgccgcaggtgtccagtgtg
aactcctccgaagaccttgacagggacatctcaaaatatgctgacccccaatcccagttg
ccaggtgaagtttcccctaagaaggtggagaatgaggcggagcttcagagtaaagaggcc
aaacccttgcctgtgccttccaaaccaaggagatgtagaaacaataaagttgggaaaaag
aagtcactccagaagaaaaatgcagcggtttctcccgataccacagtcagcgcagctgtc
ggcccggttgattccacgaatgtagatccggttttaaaggaagacactccgcctgcagtc
gaagaagtgcttcagccagaaccaaaagagtgcctccagccagaaacccagcaggtccct
ctgcctctgtcggtggaggaggagcccatacagctgccggtgaaagaggaaccggacctg
cagttgatcgatagccagaggtccgtgatgccagagagtcgagcgattgctccagaacca
tcaaaaaagagcctcaaaaagctgaaaaagcggcgcatcaacacagtgggaccgccgcag
aaacacaggcacagagggaaggatggaaagttcgctcctttaaaatcccgcaaaaacctg
agcagttgtgatgtccaggtagacggagagatttccacctcacttgcagctgctgctcct
tccccaacctccaggctcgtgggagtgcataaaaagtacaaaaaggggcgagcaggcctc
aaatacgttgaaggcaaaaggccaccgcagcaaactaaaatcatttctactctccttgaa
atggggctggacaaaggcggtctgaaacaggaggaagctgacacgccggtggacgggagg
caagcagacggcgccgcggcccatccgggtaaatccaagtttgtcaaaaacatcaagcac
ttcatcatgccggtcgtgagtgcccgatcctcgcgagtgatcaagaccccccagaggttt
atggacgatgctgggatgtctgttctgccacgaagaaactccccaaagaaaggttcccag
tttgtcttgcagccgcgtccggggaagaagagagatgatgatgatgtggagagagcgata
tcccccatacttccaatcgatgaggaggacatattgagtgaagctcagctggatgtcgat
ctgttcactgctcaggattttgaagacagccttgacatagctgattcgttgttttctgaa
agacagtgcggcacgatagaaaacaggagttcctttctgaagaactccagcttcaagtgg
cacatgcctgaggaggcgggtgaggaattgtatacactgaataaaagtccagagaggaaa
tgcgaggatctcttactctccactccggttaacaagtcaatcgagctgtcatctggcttc
ctgggagatctgaaaaagaaaagtttgcctaagtttaacaagcaggccgctcacctgaag
atctatcagaggctgaagaaaccccacatgggacttcctaagagcaggatgaccgctgag
ccagactgtttgagcaaaccccttccaccttcaatagacttagccgaaggactggacgac
gaggccatgagcatcagtctaaggcaacgagatacagtcacagagacggagaagtccaag
ctaaagatcgaggacctcaacactcctggggtcattaggaaggtttgtgttcgggctacc
aactccacatcgctggtgttgcaccacagcgaagaggaggaaatagaaaggaaagaagct
gtaaagattcccactggagagctgcgggcgaggccaaactcgggcgcggctgcatctacg
gagaagcgtgcacgcctcactggtgcaaataaaagaatgttcaatctcctcaggaaagcc
aaggttcaactctttaaaattgaccagcagaagcagctgaaatcttcagggctgttgtcc
gccacaaccggaggcagacctcaagatttagcatccaagagacagagaaggaagcagagg
gtgcagcctcatccgagtgttccagtcaagactgagccccttcaagcacaacccccgctc
atctccccgctgtgccaggagttcagaagagcaggaggtcctcggatcaagcacgtgtgt
cgagctgcctctgtggtgctcgggcagcctcgagcgctcgtgccggatgacattcccaga
ctaagcgccttgccactgcatgaaagatctggtatttctccatcacccatcgctaaagat
attggatctccatctgagtccgacagccccgaattgtctgatcaaaaagtaaccaagtcg
aaaaagccaacaaactttggaaaaaggaaagggctgggaccgtttgggtaccgctcccgg
aggtgtggggtgtgcaaaggctgcaaccacgaggaggactgcggcaaatgcataaactgc
ctcgacaaacccaagtttggagggcccaacacaaagcggcagtgttgtgtctataagaga
tgtgatcagatcgaagaaagaaaggcacgcagactgagtggaagaacggcacccaaaggt
tcctcaaagcgccgccggcggtcgttcagtgggggtcattccagtaacgaggaaggcaac
gacggcgctgtggactctccatcggctgacgggcagagtccgtctgtaaggaagcagccg
aagcgcgtcgtcaaacctcgtgtctactttgacctggtggattatgactccgatctggat
gataaggccttctccagctctgcctcaccagcgaggagaaggggtgctggacctcgcttc
agtcaagactttgtttctcttgatgggttcttggaagacacctcagaggatgaattcaga
catcgaaaatccagctcccatcgtgtgccacagggtcgacgtaaacctgagaagggtctc
ccatctccggctgcgttggaacagactcctccgagtgtcctcgcagctctggcccacgga
ttcgaacaacgacacgtcgagtcttctaaacctactcacaaaatccgggtcgacttcaag
gaggactgcaccttagagaacgtttggaatatggggggtttgagtatactgagttctgcc
cctgtcatgccaccttacgtttgcttcctgtgtgccagtaaggggcaacatgagatgttg
cactgccaagtgtgctgtgagcccttccaccggttttgccttgaaccagcagagcgcccc
tctgaggagaacaaagaaaattggtgctgcagacgctgcaagttctgtcatgtgtgcggc
aagaagaaccagctgactaagcctttattagaatgtgagcggtgccagaactgttatcac
gcttcctgtttgggacccaactatcccaaactaaacaagaaaaggaaagcctgggtttgt
atgcgatgcatcaggtgcaaaagctgcggtgtcacgccgggcaagagttgggagattgac
tggaaccacgacaaaggcctttgtccagactgttcaaaactttacgagcaggggaactac
tgtccaatctgcttcaagtgttacgaagacaatgactacgacagtcagatgatgcagtgc
ggcacatgtaatcactgggtacacgccaagtgtgaggatctgacagacgagctgtatgaa
atcctgtccagtttaccagaaagtgtggtgtactcgtgtcggccgtgcagcgtcacccag
cccagtgcctggagggagcttctttacattgaactcagggcaggggtggagaaagtcctg
gcatgcttactctcctccaccctcacccagcaccttgtcacatgctcacagtgtgaaaag
ctggttgatcctgacagtggggttgaaggcaggccggcctgtgacctccgagctgttggc
aagaagtttgataaaagcctttatacatcactgaaaatgtttcacgaagatgtggttcag
gtgatacgaaagaggctcgaacaagaagacgaccttcctgacgagcggaggcccactgcc
ctggcacgctcctactacttaaagctccttgaagaggttttcaactggttcaacagccaa
gacccaaaggtgtggaacccttgtaccaaagacttgcccgtggggatgctgtccagtggt
gtctgtccccccacaacagaacatgtgtacgcgcagtggcaggagcgggaggagcagtcg
tcccggcatccactgggtcttctgcaggaggacaaccggcagtttttggacattaaggaa
gaggatggggcgtctccgatgttgggtgatccagcgagccggaactatttcaaaagcagc
agggctctcaaatttaaaggaaaaagagggaggcttatgaaggctgactttgacactggt
tggtctaaagacgatgagaggcagtgttctttgtgtcagaaatatggcgatctcaaacct
gatgaagcaggaaggttgctgtatctgggccagaacgagtgggcccacgtcaactgttgt
ctgtggtctgcagaggtgtttgaagaggacaacggctctctgctgcatgtacacagcgct
gtcacaagggggcgcttgatgaggtgtgagcgctgcaataagacgggcgccaccgtaggc
tgctgcctgacatcctgtcagagcaactaccacttcatgtgtgcgcgttccaggcagtgt
gtcttccaggatgataagaaggtgtactgctacaaacacaggcatctcatcagtggcagg
atgatcaccggccaagaatttgaagtcaaccgcagagtgtatgtagattttgagggaatc
agcctccgcagaaagttcttgactggattggaaccagaatttatcaatgtgatgattggc
tctttgcagatcgacaaactaggtgtcctgagtgaactttcagcgagcaaaggcaaattg
tttcctgttgggtttcaatgctttcggtggtactggagtacagttaaccctctccgccgg
tgcagatacacatgtacagtccgtgaggtgcgcccagttgtcccagagaaacctattgaa
gaaatgcctgaccaaggagacaatctcaccattgctcacagcccccgtcaacttcctgaa
tctcaagcccaagagagagtttcaacagaaccccacctttcatctgaagaagcgtcagtc
caaggtcatttcataaaatccgaccacagcacaaggccaaagattcccaggaggccagcg
ggaggattgtcccgacctctgccatccccaggtgcaacccagacaaaaccccaccatatc
ctgaccataagtgatctagaagagactcgaagagctcgtcgccacagcccacactcacaa
tcctctggcatacgtggtcatggtcctccaactcccttaggtcctttacctggtccaatt
acgctccgtgccggcaaatcttcactgcccacctcccctttattgccactcggttcttct
gatagtctgatcaactctcccttatcccgccccgctggaggtagaacacactgtacatcg
tcgttctttcctcagtctccttggcaggacagtaccacctcagcaaacctgcctttctct
acaaccatgcagcatttaccccggaatcgattttcatttgatctcagccaatcagattct
gttgaagtgccgcacaactttttagcttcccctgaacccgaagacgttacaccaaatcct
gcaaatggtacatcccctcacagagagttggaaaaacaaagagacaagttttcttatgac
gcctttcacaaagactcgagcataagtctgaacgaagagatgaggaccgaactagagatt
gaagaaacattcctgaatgaaggggttgcgatgaactgtggggggcaaatagtggtggaa
gaagacgatcaggaggagttctgggaaacggcagaagaggtcccgaagaccaaaaccgtt
gctaacagtcttccgctgcttgcagcctcagccaaggaagacttggggaacacatcctct
gaagatgacatggagcactattttgatttttcacgaactatagtcagctgccaatcatca
aaagatcgctccaagtctccctcctcttctgcatctcgacatttggctcagctggatggg
atcgatgatggcacagacagtgacgcaagtgttgcaaccacagatgatgctcagaaggtg
ttcgggcccgggaaaaatccgatacaaagcaaaaatctgaacaaaaatctcccaaacatt
gaaattacaaacagttcactgaccccgaacacatcactggaaagcaggggaatggagtct
tcttctgcgacagcctcaactatcggaaaggttacgcatgactgttcacacctacatccg
ttgaaaccacttgattccagtcagagctcagactctccagcaaatcaggaaaacttattt
tctgctctcgacgacgactctttccctaacttgctcatcaaaattccagagacgacatat
tcagagaaattgttggaaactccccttttagctgaatgcgaaaatgccccccatcttact
gagctgcttcctgttctacaagacacacctctccagacccagcttgaaacctgtaaagcc
ctggacctagagcctgacgatggcgcctttgtttcgttggcagaggggtccgccgcgttg
gtgaatcacttaacatctaacatggtagtgccttcattagcagattctgcagtcaaaagc
caggacgccgtgctgggtctgcttgagtcatcccctctactgtctgcagatgcacacatc
tcttcagaaagccttgtggactccctccagatggattcttctttaccccctctcacaagc
atcactcttgaaccagtgaccactccggagtcaatgttgccgtgcacaggaccttcagct
gctaaactaacaacgctcacttctgtaggagaagttagacaaacacagatacatatttcc
actcaaaatgatccagtgctaggaacgactgtcccttgccccccagcaggatcttgccaa
gcggtttccgtgcctttgtactccacacaagcgcagccattcggttcagcggctgtcacc
atcgtttcctcctctgcctcggtagcttcactttccggactgatgacgcgctgttcggct
gctgcgataccgctgcaaaccacctccaccccagtggtcctaaacggttacagctccaca
tctttgcagaaggaagccacatctgggcacatgatttctatcaacttctccacccccagg
ccagctctagaacctcagcagccagtgcttccccaagcattacctggacatgccatcctc
actgtgaaagaggtgggaggtcctaatgtagatccgacaccacatgttctactggttaac
cggctcgggcaaatctttgtgaaaaacccagaaagtaacaccttccagcttcccactccc
aactccccttcttataactgtgtcaaccagattgccagccttttgcagagcaatgccctt
tcagccacactggcagcagccggcaacgtttcttctccgacagttggagccagcatagcg
acggctgtccccgcatcactcacacccggggtgcagaatccagcaacggttacacagctg
ctcgcccacaatagcaacggtgcagtggcatcagtgagtgtgaaaaagtccaagaaaacc
ccaaaatcttcaaaggatgaaacagtgccagagttgaaaaaaccaaaaaagaagaaagag
agtcactcttctaaaaaaccaaaaacatcaaaggttgcagggcagtcatctgaaaacaca
cctgtagcccctgttgaaagtgcccaagcaattatcaatcaagcaatggcgagtaactac
acccccaagtggggtgggctacgaacgatgagcccctcttcgctggttctcccaccgggt
cttctacttgaaccagaacctccagcatcacccccctccccagccccggcgccaccacct
gcatctcggcctcgcacccatgtccggatgaaaagggtgtcttcgctttcggaccgtatt
gtcataaaaaagtccaaagtggacttcctgcaaccagaacccagcagcgaagatgagaag
cctccgaaaatcacctttcccagcatctccagtcgggcctcaggagtgcggatcaagacc
ccgactgtgaaaggagtcctaaacctggatgagctgacagaggagcacttaagtgattct
gagagctcaggctcagagccgtggggttatttgtctcagggtgaacaagacaaaccattt
gcatgggaaactgcgggacacagcattctgaccgactggaaaaaatactctggtatttta
gttttaattaatgcaataatgcaaagatttgtttttgcttatctacttgtcatttgtcct
ttagtggcttggaaagcagtgatcgatggtgtgcaggaagctcgcgctatagcaaagctg
aggcccctgaccttccagagagtcacaggggccggcatgctgggattggtacacgacaca
gtggttttcctgttggaacaacttgaaggagctcaccgttgccagaagcacactttccgt
ttcttcaaacagcagagcccagatgatgatcttcctgttaaccctaatggctgtgctcgg
tctgagctgtatctcaggaagtctacgtttgatatgttcaactttttagcttctcagcat
agacagcttcctgacatagggccttatgatgacgaagaagatgaggttcttttgaagtct
actagacgagccactagtttggagttacccatggccatgcgcttcagacacctggagaga
acatccaaagaggccgtgggagtctacaggtctgccatccatggccgtggcctcttctgc
aagaggaacattgaagcaggcgagatggtcatcgagtatgcaggcattgtgatccgctca
gtgctcactgacaaaagagaaaagtactacgacggcaagggcatcggctgctacatgttc
cggatagacgactttgacgtggtggacgcaactatgcatggcaacgcagcgcggttcatc
aaccactcttgtgagcccaactgctactcaagggtgatcaacgtggagggacgcaagcat
atcgtcatctttgctctaagaaaaatctaccggggggaggagctcacttatgactacaag
ttccccattgaagacgccagcaacaaactgaactgcaactgtggtgcccggcgatgccgc
cgattcctcaactga

DBGET integrated database retrieval system