KEGG   Oryzias latipes (Japanese medaka): 101175203Help
Entry
101175203         CDS       T02443                                 

Definition
protein disulfide-isomerase A5-like
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101175203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 528 aa AA seqDB search
MASWNRNGNRMREAKMSTLVLLVWLLSALDAVKVSPLIDKVGDHKDFKKLLRTRTNVLVL
YTKTATSGDSHLKLLSDVAQTVKGQGTIAWVNCGDSEGRKLCKKVKVDPSSKQGGIELLH
YKDGTFHTEYNRPTTIKSMVAFLKDPSGPPLWEENPEAKDVVHIETEKEFRKLLKKEEKP
VLMMFYAPWCGVCKRMQPIFQQAATEAKGQFVLAGMNVHPSEFDGLKQEYSVKGYPTFCY
FEKGKFLYHYENYGATAKDITDWLKNPQPPQPKTPEVPWSEMDSAVFHLTDDTFDSFLEE
HPAALVMFYAPWCGHCKKMKPEYDEAAEILNKDADSPGVLAAVDATVHKALGERFKISGF
PTVKYFEKGEERYTLPHLRTKNMIVEYMHNPQAPPPPELSWEDKPSSVSHLGSEDFREAL
KKKKHALVMFYAPWCPHCKNAVPHFTTAAELFKEDRKIVFAAVDCTKGQNHEVCKQEGVE
GYPTFNHYNYGKFVERYNGDRGEAGFTGFMRSLRGRDQEKVVKRKEEL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttggaaccgcaacgggaataggatgagagaggcgaaaatgtccacgctggtg
ctgctggtgtggctgctgtctgcgttggacgctgtaaaggtgtctcctctaatagataaa
gttggtgaccacaaagacttcaagaagctcctcaggaccagaaccaacgttctagtgctc
tacacaaaaacagcaacatcgggggactcccatttgaagctgctatctgatgtcgcacaa
acagttaaaggccaagggaccattgcctgggtcaattgtggagattcggaaggccgtaaa
ctctgcaagaaagtaaaagtggatccaagttcaaaacaaggaggaatagagctgctgcat
tacaaagatggaacttttcatacagaatacaacagacctaccacaataaagtctatggta
gcattcctgaaagacccatcgggccccccactttgggaggaaaacccagaggcaaaagac
gtcgtacacattgaaacagaaaaagaattcaggaagttgttgaagaaagaggagaagcca
gtgctcatgatgttttatgctccctggtgtggagtttgtaaaagaatgcagcccattttt
cagcaagcagccactgaggcaaaaggacagtttgtactggcaggaatgaacgtccatcca
tctgagttcgatggcctaaagcaggaatacagtgtcaaaggctatccaaccttttgctac
tttgagaagggaaaattcctgtatcactacgaaaactatggtgctactgccaaggatatt
acagactggctgaagaaccctcagccccctcagccaaaaactccagaggtgccgtggtca
gagatggattctgccgtcttccatctcactgatgacacgtttgacagcttcttagaggaa
catcctgccgccctggtcatgttctacgccccgtggtgtggccactgcaagaaaatgaag
ccagaatatgatgaagctgctgaaatactcaacaaagatgcagatagtccaggagtgttg
gcagcagtggacgccacagtgcacaaggctttgggagaacgctttaagatctctggtttc
ccaaccgttaaatattttgaaaaaggagaagagagatacacattgccacaccttcgaact
aaaaacatgatagtggaatacatgcacaacccacaggcacctccaccccctgaactgtca
tgggaggataagccctcaagtgtgagccatcttggatcagaagatttcagagaagctctg
aagaagaaaaaacacgctttggtcatgttctacgctccgtggtgtcctcattgcaaaaat
gctgttccacacttcaccaccgccgcagaactttttaaagaggatcgcaagattgttttt
gctgctgtggactgcacaaaaggacagaaccacgaggtctgcaagcaggaaggggtggaa
ggttacccaacatttaaccactacaattatggaaagtttgtggaacgatataatggagat
cgtggggaggcaggctttacaggattcatgcgcagcttaagaggacgagaccaggaaaag
gtagtcaaaaggaaggaggagctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system