KEGG   Oryzias latipes (Japanese medaka): 101175270Help
Entry
101175270         CDS       T02443                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101175270
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101175270
Enzymes [BR:ola01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101175270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 858 aa AA seqDB search
MTSEWGEKSTADLMSAYVSKEAGFGVPKEGWRICLAHVFKEKRKPFQAKDVSLSNLWEHI
GLGIRYLRWWYKKTQVEKKAPFIDMFHALPLRQIYGAPLGGIGGGTITRGWRGEFCRWQL
NPGMYHYKTVIADQFTVCLRRGGQTVYQQVLSVEHPSTLQGWNWGYCGEYAFYHALYPRA
WTVYHLPGQNVTLTCRQISPVIPHDYKDSSLPVAVFVWDIENKNDYALEVSIMFTMVNGS
GHKDDSSGGHWNEPFHLEKEGKALSGVLLHHCTAVNPYTLCISAREQPDRKVSHQTAFSP
SGTCSGLWSDLMTDGRLDSPSGSSPPTQKGEKVAAALAVGCSVPAHGHNDVEFCLAWDMP
LITFGSRERKHVRRYTRYFGSKGEASPSLSHYALTHYKEWERRIEEWQSPILQDSSLPSW
YKSALFNELYFVADGGTVWTELAEDADVSGGVRSEDGGLPAQPDVIKEYGRFAYLEGQEY
RMYNTYDVHFYASFALIMLWPKLALSVQYDIAGSVVQQDLTERLHLMSGRYSPVKTKNVV
PHDIGDPDDEPWHRLNAYLIHDTAGWKDLNLKFVLQVYRDFHITQDNQYLKDMWPICQAV
MESEIKFDLDGDGLIENSGYADQTYDGWTVTGPSAYCGGLWLASLCVMCKMARLVDTERT
YQHYKDILDRGSAAFDKLLWNGKYYNYDSSGRYHSNSVMSDQCAGHWFLKASACGEEDYQ
AFPKEKIQSTLKSIFDLNVMAFAGGQMGAVNGMRPEGVPDRSSVQSDEVWIGVVYGLAAT
MIHEGMREEGMHTAEGCYRTVWERLGMAFQTPEAYCEKNIYRSLAYMRPLSIWAMQLALN
MTQKDQAPTTGDSDEVGT
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagagtggggtgagaaatccacggcggacctcatgagcgcatatgtctccaag
gaagcggggttcggggttcctaaggagggatggcgcatctgtctggcgcacgtgtttaag
gagaagaggaagcccttccaggcgaaggatgtctccttgtccaacctgtgggagcacatt
ggccttggaattaggtatttaagatggtggtacaagaagacccaagtagaaaaaaaggct
cctttcattgacatgtttcatgccctgcccttgcgccaaatctacggtgctccactgggt
gggattggaggaggaaccatcacaaggggctggaggggggagttctgcagatggcagctg
aaccctggaatgtaccactacaaaactgtaatagccgaccagtttaccgtgtgtttgcgg
cggggaggacaaactgtttaccagcaggtgctgtctgtggagcacccatccacgttacaa
ggctggaactggggttactgtggggagtacgctttctatcacgctttgtatcctcgcgcc
tggactgtgtaccacctgcccggacagaacgtcaccctcacctgcaggcagatttctcca
gtcattcctcacgattacaaggactccagtctccccgtggctgtattcgtatgggacata
gagaacaagaatgactacgctcttgaagtctctattatgtttacaatggtgaacgggtcg
ggacacaaggacgacagcagcggtggacactggaatgaaccttttcacctagagaaggag
ggcaaagcactgtcgggggtgttactccatcactgcacagcagtgaacccttacacccta
tgcatctcagctagagagcagcccgacagaaaggtcagtcaccagacggcgttcagtccc
agtgggacctgcagcggcctgtggagcgacttgatgaccgacgggcgtctcgactctcct
tcaggatccagcccaccaacccagaaaggagagaaggtagcggctgcactcgcagtgggg
tgttctgtgccagctcatggccataacgatgtggagttctgcctggcttgggacatgccc
ctaatcacctttgggtcaagggagaggaaacatgtcaggagatatactcgttactttgga
agcaaaggggaagcctccccctccctcagtcattacgctctgacacactacaaagaatgg
gagagaagaatcgaggagtggcagagtcctatactgcaggacagttctctgccctcctgg
tataagtcggctctgtttaacgagttgtactttgtggcggatggagggacggtgtggact
gagctagcagaagatgctgatgttagtggcggcgtgcgcagtgaggatgggggtctgccg
gcccagcctgatgtcatcaaggagtatggacgcttcgcttaccttgaaggtcaagagtat
agaatgtacaacacatatgatgtacatttttacgcctcctttgcacttattatgctgtgg
cccaaacttgccttgagtgtgcaatatgatattgctggcagtgttgttcagcaggacctg
acagagaggctccatctgatgagcgggaggtactctcccgtcaagaccaaaaacgtggtg
ccgcatgacatcggagacccagatgatgagccgtggcacaggcttaatgcctatctgatc
cacgacactgcaggctggaaggacctgaacctgaagtttgtgctgcaggtctacagggac
tttcatatcacccaggacaaccagtacctgaaggacatgtggcccatctgccaggctgtg
atggagtcagagatcaagtttgacttggatggagacggcctgattgagaattcaggatac
gctgatcagacatatgatggctggacggttactgggccaagtgcatattgtggtgggctg
tggttggcgtccctgtgtgtgatgtgtaaaatggccagactggtggacactgagaggacg
tatcaacattacaaagacattctggacagaggcagtgctgcttttgacaagctcctgtgg
aacggcaagtactacaactatgacagcagtgggagatatcattccaacagtgtcatgtca
gaccagtgtgcaggtcattggttccttaaagcatcagcctgtggggaagaagactatcag
gcttttcccaaagaaaagattcagagtacactgaaatccatctttgacttgaatgtgatg
gcttttgctgggggccaaatgggtgcagtcaatggcatgcgccctgaaggagtgcctgac
cgctccagtgtccagtctgatgaggtttggatcggtgttgtgtacgggctggcagcgact
atgatccatgagggcatgcgagaggaggggatgcacacagctgagggttgctaccggaca
gtatgggagaggctgggtatggccttccagactcctgaagcctattgtgagaagaacatc
taccgttctctggcttacatgaggcctcttagtatctgggccatgcagcttgctctaaac
atgacacaaaaggatcaggccccaacaactggagattcggatgaggttggaacatga

DBGET integrated database retrieval system