KEGG   Oryzias latipes (Japanese medaka): 101175270Help
Entry
101175270         CDS       T02443                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ola00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ola00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 858 aa AA seqDB search
MTSEWGEKSTADLMSAYVSKEAGFGVPKEGWRICLAHVFKEKRKPFQAKDVSLSNLWEHI
GLGIRYLRWWYKKTQVEKKAPFIDMFHALPLRQIYGAPLGGIGGGTITRGWRGEFCRWQL
NPGMYHYKTVIADQFTVCLRRGGQTVYQQVLSVEHPSTLQGWNWGYCGEYAFYHALYPRA
WTVYHLPGQNVTLTCRQISPVIPHDYKDSSLPVAVFVWDIENKNDYALEVSIMFTMVNGS
GHKDDSSGGHWNEPFHLEKEGKALSGVLLHHCTAVNPYTLCISAREQPDRKVSHQTAFSP
SGTCSGLWSDLMTDGRLDSPSGSSPPTQKGEKVAAALAVGCSVPAHGHNDVEFCLAWDMP
LITFGSRERKHVRRYTRYFGSKGEASPSLSHYALTHYKEWERRIEEWQSPILQDSSLPSW
YKSALFNELYFVADGGTVWTELAEDADVSGGVRSEDGGLPAQPDVIKEYGRFAYLEGQEY
RMYNTYDVHFYASFALIMLWPKLALSVQYDIAGSVVQQDLTERLHLMSGRYSPVKTKNVV
PHDIGDPDDEPWHRLNAYLIHDTAGWKDLNLKFVLQVYRDFHITQDNQYLKDMWPICQAV
MESEIKFDLDGDGLIENSGYADQTYDGWTVTGPSAYCGGLWLASLCVMCKMARLVDTERT
YQHYKDILDRGSAAFDKLLWNGKYYNYDSSGRYHSNSVMSDQCAGHWFLKASACGEEDYQ
AFPKEKIQSTLKSIFDLNVMAFAGGQMGAVNGMRPEGVPDRSSVQSDEVWIGVVYGLAAT
MIHEGMREEGMHTAEGCYRTVWERLGMAFQTPEAYCEKNIYRSLAYMRPLSIWAMQLALN
MTQKDQAPTTGDSDEVGT
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagagtggggtgagaaatccacggcggacctcatgagcgcatatgtctccaag
gaagcggggttcggggttcctaaggagggatggcgcatctgtctggcgcacgtgtttaag
gagaagaggaagcccttccaggcgaaggatgtctccttgtccaacctgtgggagcacatt
ggccttggaattaggtatttaagatggtggtacaagaagacccaagtagaaaaaaaggct
cctttcattgacatgtttcatgccctgcccttgcgccaaatctacggtgctccactgggt
gggattggaggaggaaccatcacaaggggctggaggggggagttctgcagatggcagctg
aaccctggaatgtaccactacaaaactgtaatagccgaccagtttaccgtgtgtttgcgg
cggggaggacaaactgtttaccagcaggtgctgtctgtggagcacccatccacgttacaa
ggctggaactggggttactgtggggagtacgctttctatcacgctttgtatcctcgcgcc
tggactgtgtaccacctgcccggacagaacgtcaccctcacctgcaggcagatttctcca
gtcattcctcacgattacaaggactccagtctccccgtggctgtattcgtatgggacata
gagaacaagaatgactacgctcttgaagtctctattatgtttacaatggtgaacgggtcg
ggacacaaggacgacagcagcggtggacactggaatgaaccttttcacctagagaaggag
ggcaaagcactgtcgggggtgttactccatcactgcacagcagtgaacccttacacccta
tgcatctcagctagagagcagcccgacagaaaggtcagtcaccagacggcgttcagtccc
agtgggacctgcagcggcctgtggagcgacttgatgaccgacgggcgtctcgactctcct
tcaggatccagcccaccaacccagaaaggagagaaggtagcggctgcactcgcagtgggg
tgttctgtgccagctcatggccataacgatgtggagttctgcctggcttgggacatgccc
ctaatcacctttgggtcaagggagaggaaacatgtcaggagatatactcgttactttgga
agcaaaggggaagcctccccctccctcagtcattacgctctgacacactacaaagaatgg
gagagaagaatcgaggagtggcagagtcctatactgcaggacagttctctgccctcctgg
tataagtcggctctgtttaacgagttgtactttgtggcggatggagggacggtgtggact
gagctagcagaagatgctgatgttagtggcggcgtgcgcagtgaggatgggggtctgccg
gcccagcctgatgtcatcaaggagtatggacgcttcgcttaccttgaaggtcaagagtat
agaatgtacaacacatatgatgtacatttttacgcctcctttgcacttattatgctgtgg
cccaaacttgccttgagtgtgcaatatgatattgctggcagtgttgttcagcaggacctg
acagagaggctccatctgatgagcgggaggtactctcccgtcaagaccaaaaacgtggtg
ccgcatgacatcggagacccagatgatgagccgtggcacaggcttaatgcctatctgatc
cacgacactgcaggctggaaggacctgaacctgaagtttgtgctgcaggtctacagggac
tttcatatcacccaggacaaccagtacctgaaggacatgtggcccatctgccaggctgtg
atggagtcagagatcaagtttgacttggatggagacggcctgattgagaattcaggatac
gctgatcagacatatgatggctggacggttactgggccaagtgcatattgtggtgggctg
tggttggcgtccctgtgtgtgatgtgtaaaatggccagactggtggacactgagaggacg
tatcaacattacaaagacattctggacagaggcagtgctgcttttgacaagctcctgtgg
aacggcaagtactacaactatgacagcagtgggagatatcattccaacagtgtcatgtca
gaccagtgtgcaggtcattggttccttaaagcatcagcctgtggggaagaagactatcag
gcttttcccaaagaaaagattcagagtacactgaaatccatctttgacttgaatgtgatg
gcttttgctgggggccaaatgggtgcagtcaatggcatgcgccctgaaggagtgcctgac
cgctccagtgtccagtctgatgaggtttggatcggtgttgtgtacgggctggcagcgact
atgatccatgagggcatgcgagaggaggggatgcacacagctgagggttgctaccggaca
gtatgggagaggctgggtatggccttccagactcctgaagcctattgtgagaagaacatc
taccgttctctggcttacatgaggcctcttagtatctgggccatgcagcttgctctaaac
atgacacaaaaggatcaggccccaacaactggagattcggatgaggttggaacatga

DBGET integrated database retrieval system