KEGG   Oryzias latipes (Japanese medaka): 101175464Help
Entry
101175464         CDS       T02443                                 

Definition
(RefSeq) glutaminase kidney isoform, mitochondrial
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101175464
   00220 Arginine biosynthesis
    101175464
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101175464
Enzymes [BR:ola01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     101175464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 538 aa AA seqDB search
CRRRKAGILPSLEDLLFYTIAEGQEKIPAHKFTTALKATGLRTGDPRLKECMEMLKVTMK
TTSDGTLDRHLFKKCVQSNIVLLTQAFRKKFVIPDFQPFCAHIDELYENAKKMPGGQVAD
YIPQLARFSPDLWAVALCTVDGQRHTVGDTKVPFCLQSCVKPLKYAIAVHDHGTDYVHRF
IGKEPSGLRFNKLFLNEEDKPHNPMVNAGAIVCTSLIKQGASNAEKFDYMMNFMNKLAGN
EYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMTSILDFYFQLCSIEVTCESAS
VMAATLANGGFCPITGERILSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGI
LLVVPNVMGIMCWSPPLDKLGNSVRGIQFCTDLVSLCNFHNYDNLRHFAKKLDPRREGGD
QRVKSVINLLFAAYTGDVSALRRFALSSMDMEQRDYDSRTALHVAAAEGHAEVVRFLLEA
CKVNPVPKDRWGNTPMDEAVHFGHHDVVTILRDYHNQYSPQDSGAKKESAENKLDGML
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
tgcaggagaaggaaggcaggcatcctgcccagcctggaggacctgctcttctacaccatt
gcagagggccaggagaagatccccgctcacaagttcaccacagctctcaaggctacaggc
ctccgcaccggagacccccggctgaaggagtgcatggagatgctgaaggtgacgatgaag
accacgtcagacggaacgctcgaccggcacctcttcaaaaagtgcgttcagagcaacatc
gttctgctcactcaggccttcaggaagaagtttgtcatcccggacttccagcctttctgc
gcccacatcgacgaactctacgagaacgccaagaaaatgcccggcggtcaggtggcggac
tacattccccagctggcccgcttcagtcccgatctgtgggccgtcgctctgtgcaccgtg
gatggacagaggcacacggtgggcgacaccaaggtccccttctgcctgcagtcgtgcgtg
aagccgctgaaatacgccatcgccgtgcacgaccacggcaccgactacgtccaccgcttc
atcggcaaggagcccagcggcctgaggttcaacaagctcttcctgaacgaggaagataaa
ccccacaaccccatggtgaacgccggcgccatcgtctgcacgtcactcatcaagcaagga
gccagcaacgccgagaagtttgactatatgatgaacttcatgaacaaactggcgggaaac
gagtacgttggtttcagcaacgccacattccagtcggagcgcgagtctggagacagaaac
ttcgccattggctactacctgaaggagaagaagtgttttccagaaggaacagacatgacc
tccatcctggacttctactttcagctttgctccatagaggtgacctgtgagagcgccagt
gtcatggcggcgacgctggccaacggcgggttctgtccaatcacaggcgagcgcatcctg
agccccgaggcggtccgaaacactctgagtctgatgcactcctgcgggatgtacgatttc
tcgggacagttcgctttccacgtcggcctgccggcgaaatcaggagtggccggtgggatt
ctgctggtcgttcccaacgtgatgggcatcatgtgctggtcccccccgctggataagttg
ggcaacagcgtgagaggcatccagttctgcacggatctggtttctctctgtaacttccac
aactacgataatctccggcactttgcaaagaaactggatcctcgtagggagggaggagac
cagagggtgaagtccgtcatcaacctgctgtttgccgcgtacacgggagacgtgtcggct
ttgaggaggttcgcgctgtcctccatggacatggagcagagggactacgactcccggacg
gcgctgcacgtggccgcagccgaaggacacgctgaggtggtccgcttcctgctggaggcc
tgtaaagtcaacccggttcccaaggacaggtgggggaacacgccgatggatgaggctgtg
cactttggccaccacgacgtggtcaccatcctccgcgactatcacaaccagtacagcccg
caggacagcggcgcgaagaaggaaagcgcggagaataagctggacgggatgctgtga

DBGET integrated database retrieval system