KEGG   Oryzias latipes (Japanese medaka): 101175471Help
Entry
101175471         CDS       T02443                                 

Definition
7-dehydrocholesterol reductase-like
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    101175471
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     101175471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 518 aa AA seqDB search
MVLWAGPISLSGYKIRGPFSAVPQRLKSLQLRLNSQLQRGLLSAVTMETTRRRAQQTSNG
KASEHAQQSAQWGRAWEVDWFSLISVVALLIFAPFIVFYFVMACDQFQCSVSEPLLQLYY
GDVTLLSIWARAPSFSWSAAKIYAVWVGFQVFLYLCVPDVTHKFIPGYVGGVQDGARTPA
GLINKYEINGLQCWLITHALWFANARYFHWFSPTIIFDNWIPLMWCANLLGYAVSTFAFV
KAYIFPTNPEDCKFTGNVFYNYMMGIEFNPRIGKWFDFKLFFNGRPGIVAWTLINLSYMS
KQQELYGTVTNSMILVNILQGIYVLDFFWNEAWYLKTIDICHDHFGWYLGWGDCVWLPYL
YTLQGLYLVYHPVQLSDASALAVLLLGLLGYYIFRSTNHQKDLFRRHDGSCTIWGRKPSF
IECSYRSADGGLHRSKLLTSGFWGVARHFNYTGDLMGSLAYCAACGLGHILPYFYIVYMT
ILLVHRCVRDEHRCSSKYGKDWKRYTDAVPYRLIPGVF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggtcttatgggcggggcctatctcccttagcggttacaaaataagaggccctttttct
gccgttccacagcggttgaagagcctccagctccggctaaactcacagctgcagcgcggt
ttgctatctgcggttaccatggagaccactaggaggcgcgcgcagcagacgtccaatggg
aaagcctctgagcacgcgcagcagtcagcacagtggggcagagcatgggaggtggactgg
ttctctctcatcagcgtggtggctctcctcatctttgctcccttcatcgtcttttacttc
gtgatggcctgtgaccagttccagtgctccgtcagcgagcctttgctgcagctttattac
ggggacgtgacgcttctctccatctgggcccgggccccctccttctcctggtcggcggct
aagatatacgccgtttgggtgggcttccaggtcttcctctacctgtgtgtccctgatgtc
acccacaagtttattccagggtatgttgggggggtgcaggatggagcacgaactcctgca
ggtctcattaacaagtatgagatcaacgggctgcagtgctggctgatcacgcatgccctg
tggttcgccaacgcccggtacttccactggttttctcccaccatcatcttcgataactgg
atcccgctgatgtggtgcgccaatttgctcggctacgccgtgtccacgtttgccttcgtc
aaggcctacatcttccccaccaaccccgaggactgcaagttcacaggaaatgtcttctac
aactacatgatgggcatcgagtttaacccgcgcatcggcaagtggttcgacttcaagctt
ttcttcaacgggcgacccggtattgtggcctggactctaatcaatctgtcctacatgtcc
aagcagcaagagttgtatggaaccgtcaccaactccatgattctggtcaacatcctgcag
gggatttacgtgctggatttcttctggaatgaggcgtggtacctgaagaccatcgacatc
tgccacgaccacttcggatggtatctgggatggggggactgcgtgtggctgccatacctg
tacacgctgcagggcctgtacctggtttaccaccccgtccagctctccgacgcctccgcc
ctcgcagtcctgctgctcggcctcctgggatattacatattccgctccaccaaccaccag
aaggatctcttccgtcgccacgatggctcctgcacaatttggggccgcaagccgtctttc
atcgaatgctcgtaccgctccgccgatggcggcttgcaccgaagcaaactgctgacgtca
ggcttctggggcgtggcccgccacttcaactacaccggggacctcatgggctctctagcc
tactgcgccgcctgcggattaggccacatacttccttacttctacatcgtgtacatgacc
atcctgctggtccaccgctgtgtgcgtgacgagcaccgctgcagcagcaagtacgggaag
gactggaagcgctacacagacgcagttccttaccgactgattcctggagtgttttag

DBGET integrated database retrieval system