KEGG   Oryzias latipes (Japanese medaka): 101175543Help
Entry
101175543         CDS       T02443                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101175543
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     101175543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 161 aa AA seqDB search
MLSYIFGLIRGGLDSVINLIFRLFFSKRRPAITLEDPNIKYALRLIDKEIVSHDTRRFRF
ALPSPEHVLGLPVGQHIYLSAKIDGKLVVRPYTPVSSDDDKGSVDLVVKVYFKGINPKFP
EGGKMSQYLESLKINDTIDFRGPSGLLVYRGRGVFDVQPEK
NT seq 485 nt NT seq  +upstreamnt  +downstreamnt
atgctctcctacatcttcggcctcatccgaggcggcctggacagcgtcatcaacctcatc
ttcagactcttcttctccaagaggagacccgccatcaccttggaggaccccaacatcaaa
tacgcgctgcgcctcatagataaggagatcgtgagtcacgacaccaggaggttccgtttt
gcgctgccctccccggagcacgtcctgggcctccctgtaggacagcacatctacctgtct
gcaaagatcgacgggaagctggtggtccggccgtacacccccgtgtccagcgacgacgac
aaaggttcagtcgacctggtggtgaaggtttacttcaaaggcatcaacccaaagtttccg
gaaggagggaagatgagtcagtacctggagagcctcaagatcaacgacaccatcgacttc
agaggccccagcgggctcctggtctacaggggcagaggggtttttgacgtccagccggaa
aaaaa

DBGET integrated database retrieval system