KEGG   Olsenella uli: Olsu_0100Help
Entry
Olsu_0100         CDS       T01285                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ols  Olsenella uli
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ols00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
115109..115711
Genome map
AA seq 200 aa AA seqDB search
MVEPTMHDGWRMDHDKIERGVRLMLAGMGEDPDREGLRETPARVARALEESCAGLCQDPA
LLFEKSFDVGCHEMVIVRDIPFYSLCEHHLLPFFGVAHVAYLPGEDGRVCGISKLARVVD
VFAKRPQVQEQLTRQVADAVMEGVGASGVLVVMEAEHLCMTMRGVRKPGAKTTTSAVRGA
FERHDATRAEAMSLIFNGTK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggtggagcccacgatgcacgacggctggcgcatggaccacgacaagatcgagcgtggc
gtgcgcctgatgctcgccggcatgggcgaggaccccgatcgcgaggggctccgtgagact
ccggctcgcgtcgcgcgcgcgcttgaggagagctgcgccggcctctgccaggacccggcc
ctcctgttcgagaagtccttcgacgtcggatgccacgagatggtcatcgtgcgcgacatc
ccgttctactcgctgtgcgagcaccacctcctgccgttctttggcgtggcgcatgtcgcc
taccttcctggggaggatgggcgcgtctgtggcatctccaagctggcccgcgtggtagac
gtcttcgccaagcgcccccaggtccaggagcagctcacccgacaggtcgccgacgccgtg
atggaaggtgtgggtgcctcgggggtcctggtggtgatggaggccgagcatctgtgcatg
accatgcgcggcgtgaggaagcccggggccaagacgaccacctcggctgtccgcggcgcg
ttcgagcgtcacgacgccacccgcgccgaggccatgagcctcatcttcaacggcaccaag
tag

DBGET integrated database retrieval system