KEGG   Olsenella uli: Olsu_0106Help
Entry
Olsu_0106         CDS       T01285                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ols  Olsenella uli
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Olsu_0106
   01230 Biosynthesis of amino acids
    Olsu_0106
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Olsu_0106
   00051 Fructose and mannose metabolism
    Olsu_0106
   00562 Inositol phosphate metabolism
    Olsu_0106
Enzymes [BR:ols01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Olsu_0106
Exosome [BR:ols04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Olsu_0106
  Exosomal proteins of bladder cancer cells
   Olsu_0106
  Exosomal proteins of melanoma cells
   Olsu_0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
120783..121493
Genome map
AA seq 236 aa AA seqDB search
MDKIVLRRPFFVVNPKSYLYGEKLRRLARKTDGLCERYGFQSLFTAQLIDLAWVADNCPH
LIPCAQAMESLRPGRGMGHVLPEALAAAGVRATFLNHAENPMTVGELARTVARAREVGIL
TCVCADSVEEAKAIAELHPDIMTCEPNSLIGTGRIAGGDYIRASTEAVKSVSPGTMVLQA
AGISTGQDVYDAIHYGGDATGGTSGIVCAGDPEAKLEEMFEALGRVRADIQGEARP
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggacaagattgttctcaggcgcccgtttttcgtcgtcaaccccaagtcctacctgtac
ggagagaagctccgcaggctcgctcgcaagacggatgggctctgcgagcgttacggcttc
cagtccctgttcaccgcacagctcatcgatctcgcttgggttgcggacaactgcccgcat
ctcatcccgtgcgctcaggccatggagagcctcaggcccggccgcggcatggggcacgtc
ctcccggaggcgctcgccgccgcaggggtgcgcgcaacgttcctcaaccacgccgagaac
cccatgacggtgggcgagctcgccaggaccgtcgcgcgtgcccgcgaggtgggcatcctc
acctgcgtgtgcgccgactccgtcgaggaggccaaggccatcgccgagctccaccccgac
atcatgacgtgcgagcccaacagcctcatcggcaccggccgcatcgccggcggggactac
atccgcgcctccaccgaggccgtcaagtccgtctcgcccgggacaatggtcctgcaggcc
gccggcatctccaccggccaggacgtctatgacgccatccactacggcggcgacgccacg
ggcggcacctcgggcatcgtctgcgcgggggaccccgaggcgaagctcgaggagatgttc
gaggcgctcggccgcgtccgcgccgacatccagggggaggcccggccatga

DBGET integrated database retrieval system