KEGG   Olsenella uli: Olsu_0142Help
Entry
Olsu_0142         CDS       T01285                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ols  Olsenella uli
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ols00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ols00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ols00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ols00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
157279..158187
Genome map
AA seq 302 aa AA seqDB search
MKAIIPAAGLGTRFLPGTKCTPKELLPVLDKPVIQYVVEEALEPDGVDGVVIVNSRLKPQ
IESYFSVDDALEEHLRAHGKDCLADKVRAAGELPVSFCYQDEARGLGHAVLCAADDAGDE
PFFVLLGDYFVPDRKMCVRMAEVSAAHGGSSVIAVAPVPEDQVSRYGIVAGERCGEVGGL
SPADDEAEGAVWKVTGLVEKPAPEDAPSHLFIVGRYLLTPRVMELLKTQGAGAGGEIQLT
DAMERLLAEEEMYAVVVDPAEGCDTGTPAAWAATNARMALGDAAQREAFLEALGERAAKQ
LA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccatcattcccgccgcgggtcttggcacgcgctttcttccgggcaccaagtgc
actcccaaggagctgctgccggtgctcgacaagcccgtcattcagtacgtggtcgaggag
gctctcgagccggatggcgtcgatggcgtcgtgatcgtgaactctcgcctgaagcctcag
atcgaatcgtatttcagcgtggatgatgcgctcgaggagcacctccgtgcgcatggtaag
gactgtctcgccgacaaggtccgcgcggccggggagcttcccgtcagcttctgctatcag
gatgaggctcgcggcttggggcatgccgtgctgtgcgccgccgacgacgcgggcgacgag
ccgttcttcgtcctcttgggcgactacttcgttcccgaccgcaagatgtgcgtgaggatg
gcggaagtatccgcagcccatggaggatcgtccgtgatcgcggtggcgcccgtacccgag
gaccaggtcagccgctacggtatcgtcgcaggcgagcgttgtggcgaggttgggggcctc
agccccgcggacgacgaggcggagggcgcggtctggaaggtcacgggtctggtcgagaag
cccgctccagaggacgcccccagccatctcttcatagtcgggcgctatctgctcaccccg
cgcgtgatggagctgctgaagacccagggcgccggtgccggcggagagatccagctcacg
gatgcgatggagcgcctgctggccgaggaggagatgtacgccgtggtcgtcgaccccgcg
gaggggtgcgatacgggcactccggcggcatgggcggcgacgaacgcccgcatggcgctc
ggcgacgcagcccagcgcgaggcgtttctcgaggcgctgggcgagagggcagccaagcag
ctggcatag

DBGET integrated database retrieval system