KEGG   Olsenella uli: Olsu_0244Help
Entry
Olsu_0244         CDS       T01285                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ols  Olsenella uli
Pathway
ols00010  Glycolysis / Gluconeogenesis
ols00260  Glycine, serine and threonine metabolism
ols00680  Methane metabolism
ols01100  Metabolic pathways
ols01110  Biosynthesis of secondary metabolites
ols01120  Microbial metabolism in diverse environments
ols01130  Biosynthesis of antibiotics
ols01200  Carbon metabolism
ols01230  Biosynthesis of amino acids
Module
ols_M00002  Glycolysis, core module involving three-carbon compounds
ols_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Olsu_0244
  Energy metabolism
   00680 Methane metabolism
    Olsu_0244
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Olsu_0244
Enzymes [BR:ols01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Olsu_0244
Membrane trafficking [BR:ols04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Olsu_0244
Exosome [BR:ols04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Olsu_0244
  Exosomal proteins of melanoma cells
   Olsu_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADK67372
UniProt: E1QYA8
Position
285057..285821
Genome map
AA seq 254 aa AA seqDB search
MAEDKYMHLVIVRHGESEWNKLNLFTGWTDVDLTETGHEEAIAGGKALHEAGYDFDVCYT
SLLKRAIHTLNHVLDELDRNWLPVHKTWRLNERHYGALQGLNKADAAAEHGEAQVKIWRR
SFDVQPPALEPGDERDPHVQEMFRDVPKGDLPYTECLKDTIARAWPYFESEIKPQMEAGK
RVLIAAHGNSLRALVMQFEHLTPEEILEVNIPTGIPCSYTFDKDWNVVDKHYIGDPATIE
AKINAVANQGKVKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagacaagtacatgcaccttgttatcgtgcgtcacggcgagtccgaatggaac
aagctcaacctcttcaccggctggaccgacgttgacctcaccgagaccggccacgaggag
gcaattgccggcggcaaggccctccatgaggccggctacgatttcgacgtgtgctacacg
tccctcctgaagcgtgcgatccacacgctcaaccatgtgctcgatgagctcgatcgcaac
tggctgcccgttcacaagacctggcgtctgaacgagcgtcactacggcgctcttcagggc
ctcaacaaggctgacgcagcggcggagcatggcgaagcccaggtcaagatctggcgtcgc
tcctttgacgtccagccgccagccctcgaacccggcgacgagcgtgaccctcacgtgcag
gagatgttccgcgatgttcccaagggggacctgccctacaccgagtgcctgaaagacacc
atcgctcgcgcatggccctacttcgagtccgagatcaagcctcagatggaagccggcaag
cgcgttctcattgcggcccacggcaacagcctccgcgccctcgtcatgcagttcgagcac
ctcactccggaagagatccttgaggtcaacatcccgaccggcatcccgtgctcctacacc
tttgataaggactggaacgttgtcgacaagcactacatcggcgatccggccaccatcgag
gcaaagatcaacgccgttgccaaccaaggaaaagtcaagaagtag

DBGET integrated database retrieval system