KEGG   Olsenella uli: Olsu_0244Help
Entry
Olsu_0244         CDS       T01285                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1 5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ols  Olsenella uli
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Olsu_0244
   01230 Biosynthesis of amino acids
    Olsu_0244
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Olsu_0244
  Energy metabolism
   00680 Methane metabolism
    Olsu_0244
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Olsu_0244
Enzymes [BR:ols01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Olsu_0244
Exosome [BR:ols04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Olsu_0244
  Exosomal proteins of melanoma cells
   Olsu_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
285057..285821
Genome map
AA seq 254 aa AA seqDB search
MAEDKYMHLVIVRHGESEWNKLNLFTGWTDVDLTETGHEEAIAGGKALHEAGYDFDVCYT
SLLKRAIHTLNHVLDELDRNWLPVHKTWRLNERHYGALQGLNKADAAAEHGEAQVKIWRR
SFDVQPPALEPGDERDPHVQEMFRDVPKGDLPYTECLKDTIARAWPYFESEIKPQMEAGK
RVLIAAHGNSLRALVMQFEHLTPEEILEVNIPTGIPCSYTFDKDWNVVDKHYIGDPATIE
AKINAVANQGKVKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagacaagtacatgcaccttgttatcgtgcgtcacggcgagtccgaatggaac
aagctcaacctcttcaccggctggaccgacgttgacctcaccgagaccggccacgaggag
gcaattgccggcggcaaggccctccatgaggccggctacgatttcgacgtgtgctacacg
tccctcctgaagcgtgcgatccacacgctcaaccatgtgctcgatgagctcgatcgcaac
tggctgcccgttcacaagacctggcgtctgaacgagcgtcactacggcgctcttcagggc
ctcaacaaggctgacgcagcggcggagcatggcgaagcccaggtcaagatctggcgtcgc
tcctttgacgtccagccgccagccctcgaacccggcgacgagcgtgaccctcacgtgcag
gagatgttccgcgatgttcccaagggggacctgccctacaccgagtgcctgaaagacacc
atcgctcgcgcatggccctacttcgagtccgagatcaagcctcagatggaagccggcaag
cgcgttctcattgcggcccacggcaacagcctccgcgccctcgtcatgcagttcgagcac
ctcactccggaagagatccttgaggtcaacatcccgaccggcatcccgtgctcctacacc
tttgataaggactggaacgttgtcgacaagcactacatcggcgatccggccaccatcgag
gcaaagatcaacgccgttgccaaccaaggaaaagtcaagaagtag

DBGET integrated database retrieval system