KEGG   Olsenella uli: Olsu_0363Help
Entry
Olsu_0363         CDS       T01285                                 

Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
ols  Olsenella uli
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Olsu_0363
Enzymes [BR:ols01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     Olsu_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
398561..399490
Genome map
AA seq 309 aa AA seqDB search
MIHTVTLNPALDKTAQAPNFKLDAVTRITELRQDPGGKGINVSKVIRQLGGTSTAWAVLG
GNTGRYIRETLAEQGIECRAFEVEGETRTNLKVIDPEGGTHTDINEPGPQVSDDMLDAML
ARLVAELDAGDIVVLAGSVARGASDDTYFGWVEACRGAGAKVFLDADGEKLVAGIRACPF
LIKPNEIELGSILGRTLDTDEKVANAARELVSRGLDNVVVSMGGAGALFVSADHVVKGGS
VRVPVGSTVGAGDSVVAALAYAEQQGLPLEDKVRLSMATGAANVMQSGTQAAPRELVDSL
VDKVSVTWL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgatccacaccgtcaccctgaatcccgccttggacaagaccgcccaggcgcccaacttc
aaactcgatgcggtgacgcgcatcaccgagctgcgccaggatcccggcggcaagggcatc
aacgtctccaaggtcatccgtcagctgggcggcacgtcgaccgcctgggccgtcctgggt
ggcaacaccggtcgctacatcagggagaccctggccgagcagggcatcgagtgccgcgcc
ttcgaggtggagggcgagacgcgcaccaacctcaaggtcatcgaccccgaggggggcacc
cacaccgacatcaacgagccgggtccccaggtcagcgatgacatgctcgacgcgatgctc
gcccgcctggtcgccgagctcgacgcgggcgacatagtggtcctcgccggcagcgtcgcg
cgcggggccagcgacgacacctacttcggctgggtcgaggcctgcaggggggctggcgcc
aaggtcttcctggacgcggacggcgagaagctggtggcgggcatcagggcttgccccttc
ctgatcaagcccaacgagatcgagctgggcagcatactggggcgcacgctcgacacggac
gagaaggtcgcgaatgccgcccgcgagctcgtctcgcggggcctggacaacgtggtcgtc
tccatggggggtgcgggagccctgttcgtgagtgccgaccatgtggtcaaaggcggctcc
gtgagggttcccgtcggttcgaccgtgggcgcgggagactccgtcgtggctgcccttgcc
tacgccgaacagcaaggcctgccccttgaggacaaggtcaggctctccatggcgaccggt
gccgccaatgtcatgcagtccggtacccaggcggccccgcgcgagctggttgactcactc
gtcgacaaggtgagcgtcacctggctatag

DBGET integrated database retrieval system